PK XD Runner Game Reviews

We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!

This game is so fun. It is better than subway surfing it is so fun with no lag.

This is ok. I only can redeem one item per day so,Whow I made it Nimda’s score but didn’t get all the parts

Too Fast. Can’t move fast enough to avoid the obstacles what happened to two hits, now one hit you’re out, this game is terrible, how on earth can score 400,000 I can’t pass 50,000!!!!

I forgot. I forgot what I was gonna write

Don’t download this game!!. There are so many glitches in this game, just like “I can’t swipe sometimes” and “they kick me out when I try to buy anything, I can’t, and it kicks me out a lot” and “quality is very low, getting points is so hard, they put coins behind the cones which makes me not able to see small obstacles.” The last thing is that it’s just an exact copy of subway surfers, subway surfers have a cop/ police officer chasing after them, and this game has a robot instead, the obstacles look the same, also mixed with the cat run game, because of the cars. I know that PKXD could’ve done way better and I don’t think this is a great way to make a game. PKXD is a very creative game, but there’s no effort at all!! Which makes me very unhappy” And when you watch the video, it never gives you the prize when you finish the add. It’s very annoying and It didn’t give me the rewards after finishing the run. The game is very irritating and frustrating. And these things are so expensive, never to forget how this is a copy of many games, subway surfers is the original and it’s more fun, graphics are great in subway surfers, and it’s very fun. I instantly deleted PKXD runner after this. Some people say that it’s good, but it’s not. This is a terrible game I don’t recommend you download it, it’s a waste of time and storage, Thank you

please read this people. Bruh y’all being a little dumb because the same people who made PK XD made this so yeah. And I like it because I like running games and I like PK XD so yeah thats all I wanted to say.

Ok you should try it out. So I got the armor in a day but other people say it’s rigged. I just got barely by 2 seconds so. But it is impossible to get the surf board if anyone does their a natural!

I don’t likes, some things. Well you know we when you crash is many times you n make the players go back to home I don’t like that so let them Play as much as they want thanks

We got a problem. So when want to get the cool stuff I have to have a account?! I don’t like that I just want the new things I want that please do something about it.😡😊🙂😇💕❤️

Pretty good, could use some improvements. It’s pretty good, my only request is that the obstacles become more visible so you don’t trip over it accidentally. Maybe it’s just meant to be this hard lol. Pretty good but could use some improvements.

I give it a one star because. It’s always hit the Earth shadow and I just don’t like it. It’s stupid for me you always lose so I don’t want him back this game by.

Cool Game. I LOVE PKXD and this game is also awesome! I love the fact that I can get reward in PKXD! Great job PKXD developers!! Keep up with good work! I love PKXD so much there’s nothing for me to tell you to fix💕 Thank you so much for your hard works and I appreciate it a lot😃 Love, Joy

Why account ?. I love this game but you have to get a account and it really bothers me a lot I just got a prize and now I have to get a account can you guys plz change it to NO account that will be helpful for everyone 😡😁

Too hard. They made this game too hard so it is too hard to get the prizes even though the prizes work it is too hard to get them

Not for me. Why do I have to sign in to get a piece of armor 😡😡 like that’s the only one and I like subway surf better I will give you a 4 stare to fix this

The best infinity runner game!. I loved PKXD runner I have been a fan of PKXD for 2 years so when I heard about this I was excited. I finished the game yesterday and the armor is my new favorite armor is super cool. Maybe lower the points required to get the full armor, it was easy for me but my friends had trouble. But that’s just a suggestion. I love PKXD runner!

Rip off of subway surfers. It’s a cool topic but it’s really just subway surfers. You do everything just like it and there is some guy chasing you. Instead of the police in subway surfers, it’s a robot. They need to make the game more like their own. When u bump into an obstacle it puts the stars over your head and what other game does that? Subway surfers.

PKXD runner. It’s fun and very challenging and worth it for the rewards this game is an awesome 👏 game

Best runner game in the entire world!. Like it’s so fun that I could play it for 48 hours nonstop and I would probably get a pretty high score .and I have a question can you actually beat the beat the game?

Great app. Thank you for the reward it works. This is the best and fun app ever

Even the rent games wanted. In the game glitch caused me to go faster and lose please can you fix it,can you add to the top in different versions?

Love this game. Best game ever I love how you can play with friends and love the details .

Obviously S tier. Dude this game is actually better than dumb subway surfers I got the glasses in da game and I think I got nothing else to say but and this is why I put after verse an s tier

The best game ever. I love this game and pkxd it a game I love btw pkxd add tradeing to pkxd EVERONE wants it pls keep doing y’all game,s can’t wait for me stuff

I suggest you don’t download this game😒. It is like subway surfers but boring you can’t change your character and I love the game pkxd in all but they did not have to make a run game 😖😖😖

This game is ok…. So don’t get me wrong, I love PKXD an all but, PKXD runner? Not a very good choice!! Why I rated this game two stars is because, one, there is A LOT of adds WICH is really annoying! Two, yeah for sure you get free things but, me honestly can’t if I had to compare this game to Subway Surfers, I would pick Subway Surfers. Three, the points go way to slow! The prizes are way to high! Four, you don’t get to pick your name, or any characters. You are stuck with playing a boy. But most players in PKXD is female, and then at the end you are stuck playing with a boy. Five, the prices for the suits in the shop is way to expensive! Lastly Six, you can’t use your coins to buy a new character! And at least you should have an option to pick the boy Adimin or make a girl called Adimina so the female don’t feel sad. Honestly, the graphics are not as gorgeous as I thought it would be, and I expected, there wouldn’t be as much glitches and then out of nowhere, an add comes up. Whenever, I try to get the suit, it kicks me out. Thank you for your time!❤️

PKXD runner is cool😎. I like PKXD Runner it’s just it’s really hard. Well it’s cool yeah like you have. To run away from the glitch it’s hard, but it’s cool they even said that if you beat this record you will get this armor it’s pretty cool I like it and you have to dodge those obstacle courses or when you lose you can watch ads or use your jams but if you watch too much at it will end and you’re gonna have to start over again, so I really like it try to beat the record to get armor

This games is the worst. I really hate this game, because every time I buy 10 amounts items in the shop, I only can use one only, and night time in this really hard to see what is up ahead of you to dogging it, I rather phay Subway Surfers than this game.

Poorly developed. The game is poorly developed and the obstacles are very hard to dodge. There are a lot of bugs and coins are impossible to get without losing

Awesome so far. I got it as soon as it came out and it’s rlly fire 🔥 no problems or nothing

ITS THE BEST GAME |BETTER THEN SUBWAY SURFERS 🤮. i love this game so much! the prizes when you complete the Challenge is very useful! (SUBWAY SURFERS) this is a boring stupid game with people saying “Oooh it’s better then Pk XD runner! PK XD) The game is better then that fat Subway Surfers! there is a Lots efforts in the game, and it’s not slow, it’s fast! I love the game and i got the pants now! all i want to be changed is How slow the admin is at first 😬, but it’s okay! i love the prizes too! ALL THE PEOPLE WITHOUT BRAINS:” It’s a mimic of Subway Surfers” You should download this game not Fat ol’ subway surfers please! Please just appreciate the efforts spoiled ramen noodle kids

Pretty epic ❤️‍🔥❤️❣️❤️‍🩹. I just started playing it today and it wasn’t bad but I kinda feel like it’s a ripoff of subway surfers but different…you play as the same person but you can change your characters clothes (personally I think the glitch looks awesome shhh🤫) and I LOVE PKXD so I’m happy the made another version of it 🤗

Good BUT you have too help me. I beat NIMDA! BUT a update came and the game won’t let me save my score please add a update that can let us keep our scores 😇😇😇

Good game but…. I love pk xd but pk runner is meh because every time I did it literally glitches and doesn’t show anything the screen is just blue which’s makes me what to go out of the game and go back in which is annoying FIX THIS 👺👹👹

Horrible. This game is horrible because it has so much glitches like when you tap the ad button to restart at the place you died it doesn’t let you no matter what you do how hard you try it won’t work I personally hate your game pls fix the game to make it better next time also question how do you even get your armor?

Love pk xd. I love thes game it’s good and pretty I can’t wait for get the armour💗

please add this. hi can you add a new armor? that gives you double points? it would be helpful for new players maybe I would cost like 10,000 coins plz 🏃‍♀️🏃🏃‍♂️

I love it but …... The game is the best ! I love how you win awards to PKXD but I have a Game Center account and it won’t let me sign in from there but I have other accounts another thing is that is sometime s I could do one move and it glitches and makes me lose and I lose my record but other wise good job pk xd it does need tiny improvements

Pretty good but. It’s good but every time I try to get the armor it kicks me out and it also doesn’t let me buy nothing like I have a lot of money but it doesn’t let me buy anything so could u fix that I really like this game but please fix it

It’s ok…. I like it for the armor but like it’s kinda well not so fun it’s really glitchy and some things I get out by because of a glitch 😡 and some items ate a little too low to the floor but I love PKXD your the best!!!!!

pkxd runner and pkxd. They give me a cool thing in pkxd so at the beginning I was thinking it was a scam but no but you have to make account in pkxd

It was supposed to be a two. I like the game but it was supposed to be 2 Can you at least add the coins when you jump you catch them it’s not the one with the magnet, without the magnet, like over it -Oh!, can you at least make it a little slower, pls thank you!

THERE IS A GLITCH ON THIS GAME FOR ME!It's like subway surfers🤔. Every time a ad comes after the ad I CAN'T SEE!And I LOSE THAT'S NO FAIR!😡the music is almost like subway surfers lol 😂 it Actually is the hole game is!🤔🤔🤔🤔😄 it’s KoriKori have a nice day 😁😁😁😁🤗🌸🌼🌸🌼🌹🌺🌹🌺🌾🌷🌷🌻big news the game is the worst. It’s just making me hate it

PKXD runner. This game was really fun and it was really confusing for me. I cannot get the armor 😡😡😡 it says you need a character in your account but I already have a character. Do you need to get this before you get the original game? Can you please fix it😦😦😦 and get rid of the account thing I already got 4 of the armor but I just need one more from this game I want to have all the armor’s😭😭 because the 4 armor that I have do not help me with anything sometimes but not mostly😔😔😔 I wish it was just a game that you get the armors with your coins from the original game is not fair that I get to see? other people with the reward and there are questions how long do you have to run to get your award? It was a minute. for me. I meant 2 minutes⏱️⏱️

Why can I not get my armor in PKXD when I tap on the collect button. When I tap on the collect button it says I do not have a avatar but I do

I can’t redeem my rewards. I tried to redeem my rewards but it wouldn’t let me. I contacted customer support and submitted my pictures but I still haven’t gotten an answer and still can’t redeem my rewards.

The good things and the bad things. when you get some thing you can’t get it like even though you logged in with PKXD but the good thing is that you earn cool stuff which is awesome

Omg! Good. The whole thing is so good and I haven’t even seen any ads

Hi I love this game!. I love this game I downloaded it because I heard I could get free armor the armor is really cool and pk XD is also really fun thanks for reading this

I love PKXD and PKXD runner. Hi I love this game PKXD it is SOOO fun and way better than Subway surfers and I love The positive messages it gives you

Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!

Love it but one thing that could change. I feel like that when you first start the game. It should have this pop up and it says for you to type your name and and your number and you press a done button. Then it shows a picture of a person and the name and the number and it also says (is this you?) and you press Yes or No.

5 star ⭐️ game. Pkxd run

Great game but... Whenever I get a high score and it says use an ad to restart and it never works when I'm on a high score which makes me rage quit all the time but overall it's really fun

It’s the Best. PKXD Runner is the best it’s fun 🤩

PKXD runner. I’m in love with PKXD runner

The score. Love the game but the score for the armour is really high in my opinion and nobody has enough free time to get the two new armour pieces

So annoying adds. There are so many ANNOYING adds in this game do not download it

Award winning. There’s so many reward’s i might collect them all and equip it on PKXD and i will be amazing so please add more award’s to PKXD please add more pleas and i hope other’s have fun as well! And we will be happy at all times. From: PKXD player: lachlangamer1st also known as MECH

Frustrating. Hi pkxd runner creator, I got this game to unlock the offers for pkxd, but it is really annoying how high scores need to be to unlock them and the fact that u loose you score and have to restart. Please read this and note this down for the future 🙏🙏

New armour🤩. So excited to get armor!!!

Increased scores. Hi I have increased scores by 30000 points

Some thing i like and don’t like about the game. 1:the jumps are way to short its so hard to jump i keep on failing 2:i love how you get sent awards to you PKXD account and how cool it is 3:you only get 3 ads every time you fail you get to choose between a ad or spend some of your gems and i really don’t like that you get an amount of ads to watch i think there should be more than 3 ads every time you fail 4:i love the cool free clothing you get when you go past someone but i think you should like instead of just clothing it would be cool to add more stuff like decor for your PKXD houses and stuff like that but this is a great game Last one or is it:the skins you get from PKXD runner look so cool i love the game super duper much and a little complain about when i try going sideways the character just rolls forward and that’s happed to me 12 times already From:Mad Jackall one of the PKXD Players out there Love the game not trying to be hateful to this game it is wonderful :) And i love the armour the shoes make you move faster!

My PKXD. I love to get the new armr because it’s so cool, but… idk what doe it do? Don’t make it limited addition cause i hust started! Thanks for reading this pkxd! Regards from Delphy and Phyu family! (My mom and dad)

Sort of a rip off. When I earned my armor I didn’t get it!

Good but I hate bugs. So I love this game and it’s so cool that u can win PKXD items in this it’s amazing but one thing that I have noticed is there is a bug just after you do a run if you try to play again it just makes the screen blue and I have to go out of the app and go back in it’s so annoying but I love this game and I don’t know if it’s just me or if it’s everyone but I love it so much.

It’s kind of annoying. Hi whenever I have almost beat Jenny when I die it’s just really really frustrating because I have put so much effort into it and I watched so much ads and spent so much gems I get nothing and it’s just really really frustrating after that also I’m 8 years old. P.S I’m just saying that it’s to hard for me

Useless to Me. I absolutely hate this game because I can’t sign in to my PKXD account so rewards I get are useless so can you please make an exception and make an automatic link to PKXD?

Do not get this game unless you like getting mad. I do not like this game it is waaaaay to hard plus I work really hard to get to the amount of points I have and then it makes me stop and I lose all my points and have to start all over again

❗️Argent you need to read ❗️. To get the amor you have to beat the leader board and about that please I’m mean please make the numbers to beat the leader board less like 1000 then 2000 and on plz but PKXD and PKXD runner are very good games I’m love them both thx😊

A great game but…. It’s really hard to move, roll and jump. The game is sometimes slow and glitches out. Also the armour can’t transfer to my Pkxd account which is sad😭 But other than that it’s a decent game👏🏼

🦶🏻❤️. I LOVE IT!

Pkxd runner. I love this it S

C. Crapppppppppppppppp

Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!

:) Love it!. Play it so so, so so so so so so so so so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so, so so so so so so good!!!!!,!,!!,!

Hate this game. It's sooo hard and just a copycat of subway surfers when you jump and duck it lasts a less than a second don't recemend

AMAZING!!!!!. I LOVE THIS GAME ITS NOT THE REAL PKXD GAME BUT ITS A UPDATE THAT WE CAN GET A FREE ARMUR AND ITS SO FUN!!!!!!!

Awesome!. Thank you for the free armour for PKXD! It’s basically the same as subway surfers but in PKXD style! The only part I don’t love is that it’s harder than subway surfers. Anyway’s good game!

OMG WOW. Omg it’s so fun it’s just like subway surfers but in pkxd, LUV IT! It’s just so amazing 🤩!

Really good But. It is really hard to get armor and the real PKXD is Better its Copying Subway surfers Its good but like 🤔 🤮

Game is awful. The hit box sucks and the jump and roll are way to short so annoying

Oh please 🙄. So I got my armour and I'm like what do I do now? Do I just delete it? What's the point? And it takes FOREVER to get the armour. It's just a waste of time. So please don’t download this scam. (Thanks)

Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!

Easy game. I will be happy for it

GIVE ME MY FREAKING ARMOR. Bruh… Really It says I need a character in my account. WHAT DOES THAT MEAN. Like a character set up, I already have one. Please Afterverse give me MY ARMOR

One small problem. The game is great but one problem.. I forgot my password on my account and the “Forgot password?” Thing doesn’t help at all!!😩 Is there a way I can get into my account by my hashtag number and username? Or any way that doesn’t involve my password? If there is then please replace it with the Login with email and password thing. Thank you for reading!😌

Jogo top. Muito top legal e top

Good game. I love it I love it I love it 😻 add more armor❤️❤️❤️❤️❤️❤️

THIS GAME IS THE BEST!. I like this game but it hard to get to 25000 from pizza guy and the best part of this game is it give you a blue armor that go fast in PKXD so I like this game.

I’m not sure what to do with it please help me PKXD run. LoL☹️☹️☹️☹️🥺

Little ideas but still love the game! :D.. So I think the game needs more details like, You can change the person running after Admin,or maybe we can make our own person to chase him. And it’s copying Subway Surfers and Talking Tom run. And it’s very glitchy.they also haven’t had a update in a MONTH we need a update about something. AND it’s just not cool. It’s like admins legs move more then his arms it’s just weird. I’m giving this a five star only for you to see it but anyway here is things you should add to the game.1.You should make it to where we can change admin into difficulty admins like Jenny or nidma and on and on. 2.You can have a scene where admin kicks glitch for a boost! 3.We should be able to change the bad guys to FLICKER and Glitch! Last one 4.We should be able to use our clothes on PKXD and add to the game to change the characters outfits instead of having to bye the original clothes. Any way that’s it but I love the game it’s cool and yeah but I would if I were you download this game. Anyway bye!

STOP IT NOW!!!!. Every time I am almost there to get to 40000 to 70000 you keep making it that I have to restart my progress because of when I die😡😡😡😡🤬🤬🤬🤬and today I was at 38000 something and I had to restart why can it save your progress next time you play got to your goal not restart all over again?😡😡😡😡😡🤬🤬🤬🤬🤬🤬😡😡😡🤬🤬

Bad. This is so trash worst game ZOOBA is better then PKXD and PKXD runner and XDRP

Gerardo. Game suc dum game it is stupit

good. this game is good and im the first review lol

I delete it in my iPad but I have it on my phone!. Hey guys check out the new update on Pk xd runner go check it out now they have a new music today and like in subscribe please please like and subscribe to my YouTube channel and also please read if you give a mouse a cookie please read it now or play class pet trip for Peppa Pig add guys play the three challenge is now everyone will go play it go to boot party time and mania

By dasthyn. Por ke mesita clave i correo

I love PKXD runner!. I like I already got the free armor and I’m loving it!

Siuuu. Siuu

I hate this. Juggyiefwigyvgfdggvyfdiygvgfdwygvgfwdjghcvsfjghcvfjhdvfgdhjwvgdhewjvvjeghfgbvgjhrwevvgvhjdevvgjhfdwvfwdhgjvvdwfhjgvfdsjgh vhgkd vvwgdjhfvvfegjghvvfehgjvvfdhgjvvsdfgjhvrfgjwhvgfdghk gefwkgh ghwfkhdg ghhfkdgfdhwhk vhhfdkv hhidwfv ghidfv fwihdhvcregwyiling

It’s good but…there are some issues. So it’s a really good game and you actually get the item from this game to PKXD but…YOU HAVE TO REGISTER TO GET THE FREAKING IDEM. And also I’m already at my third idem and it’s already in pkxd but I’m at the score 70000 but it’s not giving me my idem. Second thing is when I swipe up down side it stays in the same position and that causes me to loose.. LIKE IM SWIPING WHY ARE YOU NOT MOVING. And last thing is when I am just playing and i about to beat the score it just randomly starts loading for no reason and it’s doesn’t stop like YOU HAVE TO RESET THE DARN DIVICE OR LEAVE THE GAME TILL IT RESETS and it causes it you to loose and you’re about to beat the score and you can’t even revel yourself because of the circle in the screen which freezes the whole game but your still moving. Yeah can you fix those glitch’s please

It’s okay but a problem. Ok so to be honest it’s fine so if u like hit something 5 times it won’t let u revive plus the account thing is pretty annoying. why do u need to have a account to get the items? If u don’t have the account then can u put ur username and #? Overall it’s ok.

This is amazing!. Hi I’m Sandra I really love this game and it’s new so yea..I’m just speechless

=). Me encanta

Wow🫤. This game u,

I dislike it. It is horrible

good and bad. I like PKXD runner but I try to put a account and I put my password for PKXD but it say wrong password or because I forgot my password.when I try to switch my password it says that my username and my e mail password is wrong?!??!?

YES😘Fun as ever. Really fun I love the rewards 10/10 Fun But Like CRAZY I Was screaming RUN GET AWAY IN MY Room lol 😂

❤️. Is fun I love

Can you fix. Val

How to race. How did the heck do you race

I got the closing. Fugó: this is si oooocoo I got the Rormon

This isn’t fun. On PKXD it won’t show me my password so I can get my rewards on this game

Bruh. It keep saying I am still lvl 1 but I play this almost everyday fix it (Not worth buying)HATE U 🫵🏼🫵🏼🫵🏼🙄bOrInG HFHCMUBFGUBGY TYHC 5VTWRGCFYGCWYGCYHQFCYQEFCQGFYCRQ YCGRQGDRQ GYDRGYGATYFCGYRGCYRGCEYDHEUHDUEJSIWIRHCHFURHFYHRFYRHRUCUHEUHRUDH!

Ugh. Stupid game literally I was on last level then I watched an ad then it didn't let me press x so then I had to give up it happened many time but you can get ugh armors😔 . 🌹 🌹 🌿 🌹🌹 🌿 🍁🍁 🌿 🌿 🍁🌹🍁🌿🌿 🍁·🍁🌿🌿 🌿🌿 🍁🍁🍁🌹 🌿🌹 🌿 🍁🍁🌹🌹🌹.🌿 🌿 🍁🍁🌹🌿🌿 🍃████🌹 ▉▉▉▉▉▉ ♡♡♡●▏ ▊♥♥♥ ▍※※※※▍ ╰▃▃▃▃╯ 🌺🌺🌺🌺 🌺🌼🌼🌼🌺 🌺🌼☀🌼🌺 🌺🌼🌼🌼🌺 🌺🌺🌺🌺 🌱 🌱🍃 🌱 👶🌱 👚👍 👟👟 🌺🌺🌺🌺 🌺🌼🌼🌼🌺 🌺🌼☀🌼🌺 🌺🌼🌼🌼🌺 🌺🌺🌺🌺 🌱 🌱🍃 🌱 👶🌱 👚👍 👟👟 🌺🌺🌺🌺 🌺🌼🌼🌼🌺 🌺🌼☀🌼🌺 🌺🌼🌼🌼🌺 🌺🌺🌺🌺 🌱 🌱🍃 🌱 👶🌱 👚👍 👟👟 🌺🌺🌺🌺 🌺🌼🌼🌼🌺 🌺🌼☀🌼🌺 🌺🌼🌼🌼🌺 🌺🌺🌺🌺 🌱 🌱🍃 🌱 👶🌱 👚👍 👟👟 ☁☁☁☁☁☁☁ ☀ 🐦 🐧 🐤 🐦 🐤 🐧 🐦 🐔 🐥 🌻🌻🌹🌷🌷🌳🌳 ☁☁☁☁☁☁☁ ☀ 🐦 🐧 🐤 🐦 🐤 🐧 🐦 🐔 🐥 🌻🌻🌹🌷🌷🌳🌳 🔅 🔅 🔆 🔅 🔆☀🔆 🔅🔆☀🌞☀🔆🔅 🔆☀🔆 🔅 🔆 🔅 🔅 ☁☁☁⛅☁ 💦💧☔💧💦 🌳💧👫〰🐕 💧💧💧💧💧💧💧♦ 💧😩💧💧💧💧♦☀ 👇👕👎💧💧♦☀☀ 💧👖💧💧♦☀☀☀ 💧👟👟♦☀😃☀☀ 💧💧♦☀👆👚👍☀ 💧♦☀☀☀👖☀☀ ♦☀☀☀☀👟👟☀ ☁☁☁☁☁☁ 💧💧💧⚡💧💧 💧💧⚡💧💦📡 💧⚡💧💧🏢🏢 💧💧💧💧🏢🏢 💧💧💧💧🙋🏢 💧☔💧💧🏢🏢 💦🏃💦💦🏢🏢 🌊🌊🌊🌊🌊🌊 🔻 🔴 🍞🔴🍞 🍞 🔴🍞 🍞 🔴🍞 🍞 🔴🍞 🍞🔴🍞 🐶 🐹 🐷 🍖👕🍛👚🍫👗🍹 👖 👖 👖 🏃🚄💨💨💨 coming! 🟨🟨🟨🟨🟨🟨🟨🟨 🟨🟨🟨🟨🟨🟨🟨🟨 🟨🟨🟨🟥🟥🟨🟨🟨 🟨⬛⬛🟨🟨⬛⬛🟨 ⬛⬛🟦⬛⬛🟦⬛⬛ 🟨🟨⬛⬛⬛⬛🟨🟨 🟨⬛⬛🔲🔲⬛⬛🟨 🟨⬛⬛🔲🔲⬛⬛🟨 ⓑⓤⓜⓑⓛⓔⓑⓔⓔ 🟪🟪　　　　　🟪🟪 🟪🟪　　　　　🟪🟪 ⬛⬛⬛🟪🟪⬛⬛⬛ ⬛⬜⬜🟪🟪⬜⬜⬛ ⬛⬜🟥🟪🟪🟥⬜⬛ 🟪🟪🟪⬛⬛🟪🟪🟪 🟪🟪🟪🟪🟪🟪🟪🟪 🟪🟪🔲🔲🔲🔲🟪🟪 　　FNaF Bonnie 🟨🟨🟨🟨🟨🟨🟨🟨 🟨🟨🟨🟨🟨🟨🟨🟨 🟨🟨🟨🟥🟥🟨🟨🟨 🟨⬛⬛🟨🟨⬛⬛🟨 ⬛⬛🟦⬛⬛🟦⬛⬛ 🟨🟨⬛⬛⬛⬛🟨🟨 🟨⬛⬛🔲🔲⬛⬛🟨 🟨⬛⬛🔲🔲⬛⬛🟨 ⓑⓤⓜⓑⓛⓔⓑⓔⓔ 🟦　　　　　　　　 🟦 🟦⬜⬜🟦🟦⬜⬜🟦 🟦🟦🟦🟦🟦🟦🟦🟦 🟦🟦🟦⬜⬜🟦🟦🟦 🟦🟩🟩🟦🟦🟩🟩🟦 🟦⬜⬜🔲🔲⬜⬜🟦 🟦⬜⬜🟥🟥⬜⬜🟦 🟦🟦🟦⬜⬜🟦🟦🟦 Optimus Prime 🟨🟨🟨🟨🟨🟨🟨🟨 🟨🟨🟨🟨🟨🟨🟨🟨 🟨🟨🟨🟥🟥🟨🟨🟨 🟨⬛⬛🟨🟨⬛⬛🟨 ⬛⬛🟦⬛⬛🟦⬛⬛ 🟨🟨⬛⬛⬛⬛🟨🟨 🟨⬛⬛🔲🔲⬛⬛🟨 🟨⬛⬛🔲🔲⬛⬛🟨 ⓑⓤⓜⓑⓛⓔⓑⓔⓔ 🟦　　　　　　　　 🟦 🟦⬜⬜🟦🟦⬜⬜🟦 🟦🟦🟦🟦🟦🟦🟦🟦 🟦🟦🟦⬜⬜🟦🟦🟦 🟦🟩🟩🟦🟦🟩🟩🟦 🟦⬜⬜🔲🔲⬜⬜🟦 🟦⬜⬜🟥🟥⬜⬜🟦 🟦🟦🟦⬜⬜🟦🟦🟦 Optimus Prime 🟫🟫　　　　　　🟫🟫 🟫🟫🟫🟫🟫🟫🟫🟫 ⬛⬛⬛🟫🟫⬛⬛⬛ 🟫⬜🟦🟫🟫🟦⬜🟫 🟫🟫🟫⬛⬛🟫🟫🟫 🟫🟫🟫🟫🟫🟫🟫🟫 🟫🔲🔲🔲🔲🔲🔲🟫 🟫🟫🟫🟫🟫🟫🟫🟫 　　FNaF Freddy 🟦　　　　　　　　 🟦 🟦⬜⬜🟦🟦⬜⬜🟦 🟦🟦🟦🟦🟦🟦🟦🟦 🟦🟦🟦⬜⬜🟦🟦🟦 🟦🟩🟩🟦🟦🟩🟩🟦 🟦⬜⬜🔲🔲⬜⬜🟦 🟦⬜⬜🟥🟥⬜⬜🟦 🟦🟦🟦⬜⬜🟦🟦🟦 Optimus Prime

Pkxd. The game is really cool and fun🤩

Nice ig. It’s ok but it kinda gets boring after like 5 hours so yea 5out of 10

This Could Be better. Idea:Instead Of Loging In Can We Just Enter Our Username And Number (In the Normal pkxd game)And Then We can Get Our Armor

THE BEST GAME!!!!!. Best thing for beginners that don't have amro

Fun. So fun

Hi. It's awesome and fun

Super awesome. It’s such a good game. Since I play PKXD I am in love with this game

Good but not good. I’m starting but m

Pk xd. Me encanta pk xd me encanta miraculous ladibug