Real Fireworks Visualizer App Reviews

We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!

Fantastic. My kids love it

Exactly what you should get. I've read all the dissatisfied device owners about the disappointment and sometimes aggressive tone toward this companies product. And I've got to say, I'm not surprised, in this world of young adults where in their mind (more than likely born from being cottled as a child) think they should get everything for free. Well, that's another time, but, I think for 4.99 this app delivers exactly what you want for a screensaver, ITS NOT A GAME, and honestly if you don't want to pay for things in life you don't really want them.....do you, hmmm?

Horrible. It is horrible you just tap and it a Minnie firework comes or there's a big firework. DONT get this app I deleted it as soon as I got it bye

OMG this rocks. This game rocks it's like the best fire works game ever that was created!but sadly there are somethings like different types of fireworks that are locked and I don't know why! But other than that the app rocks you should totally get it if you love explosions and having fun!and you don't have to wait till the fourth of July to see and hear amazing colorful fireworks!!i love the big ones the most💗EXPLODE! Hahaha enjoy! I'm only giving it four stars because I can't unlock certain things.

It's ok. It is a good thing to do when your are bored and have nothing to do. Other then that it is not a very good app. I think it's pretty and all but there is really not that exciting. It's great to help you fall asleep but other then that, not a great app. I think you should get it and see what you think.

This app is amazing!. Don't listen to the review that says it makes you pay five dollars after two minutes, because it doesn't! I love fireworks and I need them for a music video for my band and it is perfect!

Little One. I like the app for my little one although I do not like this app because if it for a baby why in the world do the people have advertisements on it like why????????

I got blessed by the tooth fairy. So I can change the size,gravity,tail length,and particle size, THESE CONTROLS LAST FOREVER TO ME!!!Story: When I lost a tooth I was finishing lexia! When it was bedtime I put the tooth under the pillow. Then when I woke up I checked my iPad and saw that the controls can be unlocked and stay that way forever! Horray!

Horrible game. Game crash every time you press start

Free is not enough -- developer should pay you to download. Fireworks simulation is real enough if you even notice the fireworks with the constantly changing humongous 3/4 inch iAd banner at the top of the screen that never goes away. Every conceivable setting and customization is locked for upgrade payment behind a Windows XP looking control panel interface that is sure to make you think of the 1990's. If you haven't downloaded it, don't bother. If you have, you will find yourself doing what I will be doing after writing this review -- deleting it and instructing the AppStore application to hide it from my purchase history. Even a FREE app demands to be better then this thing.

WORST APP EVER!!!!!!!!!!!!!!!!. NEVER BYE THIS APP!!!!!!!!!!

AWESOME APP. This app is really cool.I love this app because if you can't see fire works on the Fourth of July then you can see it on this app!!!! In other cases if you just want to see fire works on a regular day then this is your app!!! I highly recommend this app!!

You no what your missing. I don't like this app get the full version it's BETTER this one is sooooooooooooooooooooo Much worse don't get this one I mean fireworks in February that's cool but that's the only cool part listen to me it's real don't get this app get the full version I love the full version this version makes me sad I bot it for nothing I think kids teenagers and adults should all get the full version this one is no fair because you see them do the fireworks and their huge and then when we do it it's tiny it's not fair don't get this app if you do you will be Sorry that you got it trust me don't get it's app it's HORRIBLE

Two minutes. All features unlocked for only two minutes without explaining to you how to do anything? Stupid.

I hate this app!!. I have two things I hate the most: first, it only gives u the full version for TWO MINUTES!! Then, all u can do is watch the fireworks which is no fun at all. Second, there are way too many ads!! And after every ad, it asks u if u want to remove them every time! IT IS SO ANNOYING! If u are going to download this app, please don't because u most likely are going to hate it. IT IS NOT WORTH IT!!!

Ads make app not appropriate for young children. The app itself is good. I downloaded it to use with my students with autism to help them prepare for viewing fireworks. However the ad for Zombie Jombie that keeps appearing across the top of the screen is not appropriate for young children. So I can't really use the app.

Kate👧 cop👮 Kate the app cop. Playing this game is against the law! U no y😾? Because all u doo is tap the screen 2 make tinee Fire🔥 works! + The cuntrols r lokt! It shos that u can dro in it, but u can't! If u play this u r gilty.

Great!!. I totally love this app, but the adds are always in the way. When you make the fireworks, you can only make small ones. I wish I could make the fireworks bigger!!!!!!!!!!!

Boom boom pow!!!. I think that this game is the best out all firework games. Although when you get a free gift I think it should last like days because I am not aloud to buy a lot of things. Even for 0.99. So I really thunk you should change that FAST!!!!!!!!!!!!

Awesome. I have so much fun playing with this app. It's fantastic to watch fireworks. I suggest this app because you really get to know fireworks and how colorful they can be! FIVE STAR APP

I find it likable and fun. It runs on it's own and is adjustable.

😡TERRIBLE APP. Look it looks nice but it costs like 5$ to unlock the controls also the fire works you put us with are terrible small little things glowing in the air, and I don't see how it's the "best seller app off 4th of July!" And "best seller firework app!" Because it's not some people may not agree and say yea it's the best or whatever but this is my opinion and nobody can change that unless they made this app better the only and barley "good" thing about it is that it at least let you make fireworks anybody out there who reads this comment by every word, I suggest not to get this app.!

Worst ever. You think it's free it is for 20seconds then you have to pay for the rest a bad game

Fun. This app is so fun😛😝😜😋😎👽👍

PATHETIC. INSTEAD OF THE END USER getting hammered by advertising. Why dont we all demand that a portion of Tim Cook’s $300 million dollar annual salary be allocated to pay some of these developers instead of us spending SO MUCH money to buy those devices so that we can get LITERALLY HAMMERED BY Ads. I timed this one at every 8 to 9 seconds, regardless if I even pressed a button inside the interface. Because if I actually touched something inside the app, the advertising was IMMEDIATELY letting me have it. Total app time usage maybe 45 seconds to a minute. Total advertising that I got to experience 12. Twelve lovely ads in less time then it actually took me to write and rate this piece of …. app. ANNOYING!! Steve Jobs is rolling over in his grave right now!!

Worst app ever. You have 2 minutes of playing then it gets rid of all fireworks and modes it even said pay 0.99 for options and $4.99 to play again >:(

No look at this 👎🏽👎🏽👎🏽👎🏽👎🏽👎🏽👎🏽👎🏽👎🏽👎🏽👇🏽. This is so lame it cost like 5$ to unlock o thing

Not pretty good. I don't like this game because when I put a big size it just makes it small and I can't make shape fire works and I can't get the fire works size back to normal so I don't like it

Cool app. Wow this game is a hit !!!!!

Ohh purleeze fix!!. Installed this three time and finally got it loaded and just show me the opening and then it went back to home screen!! Will keep this til updates likebu promised. But it better be quick or it will be deleted!! Not going to have this waste my space!! :-( five stars only if u promise ton fix this!!

What a Beautiful App!!!. I'm crazy about this app. It has lovely colors and it looks so real. Two thumbs up.

I love it.. I love this app it's amazing it's like real fireworks I don't see fireworks everyday just like that, but with this app I can see fireworks anytime I want. I rate this app 5 stars.

Fantastic!!. Love how you can make your own!

Overwhelmed by garbage. Downloaded this for my five year old. The fireworks simulations are okay, but nothing special. Sparse particles in the explosions, decay overly rapid, and the colors meh. The app is completely useless for two minutes after you open it, while you're stuck looking at worthless ads. Then you get a couple of minutes where you can actually play with the fireworks, followed by another worthless ad block. Uninstalled after using it for less than five minutes.

Booooooo.!. This is the worst game I ever played and I can’t make the fireworks any bigger it’s like this small🦷it’s like a small as a tooth 🦷do I get this one star now I’m going to go and play with my friends Aubrey And Tor tor so I will see you later goodbye🙄👋🏻😒

TERRIBLE MAKES ME MADD👎👎👎👎. SO I JUST STARTED TO PLAY AND THE FIRST CLICKK THERE WAS AND ADD 2.3 SECONDS LATER AAAAGGGAAAIIIIINNN!!!!!!!!!!😡😤👿😡 DONT DOWNLOAD AGGGGGGGGGHHHHHHHHHHHHHH!!!!!!!!!!!!!!!!!!!!!!

Excellent App!!!. I can't say enough about this app. It really is fun for everyone who appreciates having a little fun. I would give it more than 5 stars if possible.

Harassment do. This game looks fun but it’s not. This game is only fun for about a minute or so and then when I started playing the game it was pretty cool until this and kept on popping up it kept on saying do you want the full experience or do you want half experience for the columns. Every time I play the game if I touch the screen or anything add add add. Do not play this game do not play this game.

Disappointment. It looks fun and all but when you buy it you get the full version for 2 minutes and when time is up you only get 1 firework mode and you can't control the color or anything so if you download it don't get disappointed like I was 😉

STINKS. This app stinks!!!!!! You have like 2 minutes until the app goes gaga on you!!! I BARELY WRITE REVIEWS SO THIS APP STINKS LIKE POO

Read this before you download.... DO NOT download this game it's super lame you have to pay for the controls to make it fun this is the lamest game of the year if you are already downloading this lame game make it stop or you can see for your self but you WILL be disappointed with yourself just saying . And this is for the makers of the game.....if you want this game to be at the top of the list MAKE THIS GAME WWWAAAYYYYY BETTER THAN ITS NOW!!!!!!!! And I agree strongly with +Haley also read her comment too horrible game just so horrible uuuuggggghhhh just eewww I'm mad now

I HATE THIS APP. There are little features that are unlocked and the all the other ones are locked complete garbage

Boring. THIS IS SO BORING!!!! IM GONNA TAKE A CHAINSAW AND DISLIKE THIS WHOLE GAME AND LIGHT THE FIREWORKS AIMING FOR YOUR FREAKING HOUSE AND IT WIL BURN TO THE GROUND AND ILL DESTROY THIS APP

Good. I like this app but it could be better. The reason for the four stars is it doesn't have any kick to it. I mean to make someone really like it.

Seriously 😒😴. This app is good like for the first 10 seconds then you have to pay 5 bucks for.... Everything - - /---\ !!!!!

Worst app ever😡. U can't do anything in the app u have to buy it all and if u want to buy the app DONT!!!!

Awesome App 👍. This app is really awesome!!!

Do not get boring. Believe me this is so boring when you first get it you are so happy and after playing it for two minutes you are so bored

Worst game ever. You can't use the controls won't let you pick your color worst game!!!!!

Fun for 2 minutes 😡. It's only fun for 2 minutes when I got the gift to unlock everything after that it just got boring 😡 you could get the app and you will see what I mean Jocelyne 💋

Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!

Nothing. I love this game

What. Yuck this is the worst game ever!😪😡🤧😾🦐

😐😡😐. Make the full version free. Also let it so we can video! 😡😤😡😤😡😤😡😤😡😤😡😤...otherwise it's awesome!!!😜😝😜😝😜😝😜

fireworks. its really good ok geez get it already

Cute. My nieces nd nephews love this.

nice. it's a nice app.

Love it so much. I loved it how did you make it

Ok. I think it's ok my favourite one was the love heart. I wish you could make the full version longer and free (: Thanks so much I rate it 3 stars

Allsom!!!!!!!. It is cool

RIP OFF, waste of time and never get this game 😡🤬!!!!. We wish we could get our money back, paid $8 to unlock everything and it did not do anything! It only let’s you do 3 things. Wasted our money💲😭😢.

Terrible game. It really wasn't a good game at all because unless you bought the full version everything was locked!

Bad. This game is not very good it does not let you do what you want you just sit there taping the iPad or iPod

Fireworks. Awesome almost real, great in a dark room with no lights, even better when you connect it to a big screen tv

Worst app ever. I hated how everything was locked i had 1 firework option and couldnt adjust the sizes it only gave me 2 minutes of the full version that was the only good part worst app ever and im rating 1 star

Real fireworks hd FREE. Cool little app. If the developers made it so it would sync with your music it would be a must have! All in all it's a good display to have running on your iPad at your next party.

Laurel. Best game ever made

Awesome. This app is a great app:)

Ads everywhere. Other better free fireworks apps. Don’t get this one.

Awseme. Pretty cool

Bad. Wow all the settings are locked unless you pay ransom. Pathetic considering how basic it is. Delete and one star.

Mr.. Gr8 stuff...

Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!

Very good is interesting. Is very fun, but I think you will need more things

Awesome app. I love it! I am gonna tell my friends!

Awesome!. Love it apsoulutsley love it.😍like ice cream with a cherry🍦🍒

Worst. Pop ups, bugs all the worst

Awesome. $$

It's okay. This app is okay it can be better but at the end it's pretty cool

Nice. Awesome it's really cool the only reason I didn't put 5 stars is because it keeps annoying me to rate and buy the full version

Rating. This app is bad it just locked everything or almost everything

FCC. CDC

Pat. I love fireworks - it is a happy place to go!! Thank you!!

Love. This is so good I love it WOW

Fun & annoying. Good game but it stays on auto and wrecks you own display Get the full version .

Fun app. Funny app - I took a pic and tricked my friend in to believing I was at DisneyLand watching the fireworks!😝😝😝Great app if your looking for a new screensaver.

Worst. Pop up, ad, pop up ad, ask to buy, ad. Brutal, you can't even try it. Uninstall this nonsense, do not download this.

The best game ever. It is the best it gives you screen savers and it is pretty and you can project it on walls any Where use it at weddings just for it to look nice.I think this Is a nice app you should get it it it's nice see I'm I'm studdering to say tha thaaaaat so get this app plllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll,lllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll,lllllllllllllllllllllllllllll,lllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllłlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll,lllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll,llllllllllllllllllllllllllllll,lllllllllllllllllllllllllllllllllzžxzzzdihggktfgkuyjfjfutdyfjdyhjvddthyrdtrsfhdgfshkgjghjhgjyfjgfhcjjhfjhfhjfgffhdfdjhcjdhdhjfjjhfjyfjhfjyfjyfjgcghdghdjgdjgccgjcgjjgdgjcjcgcjgjcgjgdjdghdghgdgdhjdgjgdjgdgsgkuhteyreuyreytrrtytttruutrytrhfthfgghfghfghfhfggfhghfgfhvhgghvhfgghvyhfhvgghffthcvhgfghfhtgfhhfghfhtfhghgghgghgggvhvhghvgvhgfhghghhijhhvgvghvhghvghvghgggghjhgghvhvhghvhvghgvgvhgvhhvggvhhgvhjghhggghghvhgvgvhhgghfhffgfcggfhfthtftnfnytftnfngtfnrgfnbgnrdgbrddtrbtrdbtnrdgrnf htftfhthfhftthfftgrftfyftntrdtrhdtrngfcngfc fyttyfytfftnfythftytfmmyftyftyftmtmyfytmftymfmtyfyfmymtyttytyttytytytytytyttyytukkjgjfhtdytdyrjdyjrddmtymdut,u,to,hftytfmhtmmhtfhtfmhmtthfmmthfhfmthgfmfhmffhmhmfftymmhftmtfhhmtffgfmfgfmfngftnfgfngnghfmhftfgftmggmffgtfmfgfngfmttgfmthfmnrdggrnddnrdnrndrbdngr ngndrngrdtdrrtdndnrtthedhreshtzeteshrthasnrttsrsryntrjsgrnsgnfsgrdrsyntdnytsmtysynsrsrnggnrsnsyrrgnsnfdqwertyuiopasdfghjklzx cvbnm,.qwertyuiopllaksjdhfhgzxvcbvnm,.qwertyuiopasdfgi O Qwertyuiopasdfghjklxzxxcfbnmlkxqwertyuiopzasdfghjkl,biz qwertyuiopasdffggghhjkkllzxbnqwertyuiopasdfghjklzxcvbnm,.1234567890-/:;()$&@.,?!','"' ''[]{}#^^.

Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!

Cool. It's a great game but the limited time with the more options stink

I hate this app!!!:(. This app is terrible! Every time I want to open it, it doesn't do anything. It just shows a pic. Of some fireworks and then goes back to the home screen. I DO NOT recommend this to anyone.

Awesome app!. It's awesome app it has realistic fireworks,the thing the I don't like is the ads and the pop-ups

It's great!. I LOVE IT! But I think it should have more features.

ewww ahhhh. Now I don't have an excuse to break the law in my backyard this year :( Very cool app and realistic effects.

Nice. Really cool. Would be nice if the user can capture the screen and safe a pic of the fantastic display. Thank u!

Fire works. I don't really like this game because I don't have the full version and if you want to know my na me and age my name is Tabitha and my age is 8

Real. Sooooooooooo real looking and sounding!!! I do wish that u could do more on it though!!

Rate. It's ok but it needs more things to do people don't just want to sit there and look at fireworks the whole time make it cool.

Eeeeeeh. Well at first I was having fun till I messed up settings now I can't do it by myself it just duz it randomly

😔. A lot of bugs and other problems!!

Awesome. I love this game it is the best and so i played and it was soooooooooooooooooooooooooooooooooo cool and i just wanted to put that out there

This stinks!. At the beginning it was totally awesome, but then after I played for about 5 minutes, it wouldn't let me pick any of the even decent choices of fireworks! until it sent me to a notification if I want to get the full version, or get a "free gift", which is just getting to pick what fireworks I wanna make!

Great:). I missed fireworks this year, but now I can watch them anytime. Love it:)

Awesome. I love this app it's fun the colors are so real u don't see that in free apps anymore until now :D

The kids love it!. My little cousins love it just as much as I do!!!

Poor Quality. This is not real fireworks, and not even good quality digital lights sorry, I just do not think it is at all interesting, or of any modern quality

Ads, ads, ads... and some fireworks. Surprising they could even fit the fireworks on screen with all the ads, cross-promotion of other apps, pop ups, pop overs, and general junk on the screen.

i love it!. 'I've always loved fireworks and now i can experience it when ever i want!

Perfects. I love if u like fireworks buy this app

Fun. This game is awesome you get to creat your unwanted fireworks while there are others the back ground

Awesomeness. This game is so awesome, and the sound effects are great too!

WOW!!. For anyone who loves fireworks...this is great for a free app. Eventually I'll pay for the whole "sh-bang!"

Review. Love it :) <3 having so much fun

OMG😃😃. This is so fun I like watching the fireworks explode in the dark it's so cool! Kk gtg play the with the fireworks some more😄😄.

Wow!. The fireworks look so real I could use it for the 4th of July.

This is cool. This is really cool and I like this app and when you are bord you can do this

fireworks. This game is awesome! Everyone should get it!

Free version = not much!. The fireworks are cool & sounds too!! BUT-the free version that I just downloaded doesn't let you do anything but touch the screen to create a few very small firework bursts on top of a preset show of bigger bursts created by the app maker. In my opinion free version not worth the download space it takes up. :-(

Cashier. It is so realistic

Absolutely cool. It is so cool having your own fireworks show.

Pretty. Really handsome fire works.

Tooter. Love the app. I can't wait for July 4th. Will have a big "safe" fireworks show at the house...

The best app anyone will ever have?!!. Thank god for this app my brother has autism and this the only that will help him calm down!

Fireworks. This is a way cool app to play with the lights off!

Nice!. I am so amazed with the effects of the fireworks though it has limited firework display, i still enjoy it!

Goes back to the home screen. When I 1st got this app, it was awesome! But then after a while, it went back to the home screen! I tried installing again but the same thing happened.

Fireworks spectacular!. This is a unique app. I love it! Can play around with it and position the fireworks around all differently. So cool!

Free is just teaser..not worth the price. Downloaded, watched a couple times...cannot change any settings. Then push started to "upgrade" to full version. Deleted as "bait and switch". Also disappointed as it was recommended by a popular blog with no mention of lack of features.

So much Fun!!!. This app is so much fun and soooo entertaining!!! My friends and I really love fireworks, so this app is great for us when we get together because we can't always set off fireworks!!! I recommend this app to everybody!!! It's great!!!!!

Not as fun as you think. Without the full version you can't do anything so basically I hate and love it boring! Fun! Bye!bye

Fireworks. I think this is one of the best games it's fun to make the fireworks bigger and move them :)

Fun while it lasted. It has been my favorite game until I reached a higher level at which timed it froze and I now can't play it. Hoping I didn't pay for it. But I like it enough that I'll try downloading it again.

Fireworks. Fun! And I can turn the volume down--even better!

Like or hate. This is kinda crappy because I updated my app and it stayed the same. It's still OK to play around with though.

Awesome!!. I think you can do ore but so far this is and awesome app!!!

Almost real!. This is one of the best simulated fireworks I have seen. I just wish the screen was bigger. Enjoy!

It's ok but 1 thing. I love this game but the stupid thing about this game is that you can't make the big fireworks I say a yes-no so you can do what ever you want!!!!! :)

Awesome!. It is awesome I can use it for design thanks

Don't even think about. At first they only give u 60 sec. To experiment and try the stuff in there and then u have to buy in order to get the full version of it ;(