Emergency Vehicles at Car Wash Game Reviews
Emergency Vehicles at Car Wash Game Description & Overview
What is emergency vehicles at car wash app? You can serve your country right and you can do it by simply practicing this car game where not only that you will have in your custody the emergency vehicle of your state, but you also get to recreate their design and you will be able to put your mark in there. So use the tools you have and try to make each task in the way it should be done. Wet it, add shampoo, rub the dirt and dry it all. Wash well the smutty window, add the missing piece and handle all those scratches that are spread on the car body. The broken wheel needs to be pumped and when you are done the only thing that is left is the polishing phase where you actually finalize the aspect of each vehicle. You will begin with the police motorcycle and you go on with the fire truck followed by the ambulance car. You need to be aware of the importance of a proper functional car and you will ensure that the necessary standards are fulfilled. Once you get through the cleaning and fixing part you will be skipping to the designing step.Combine colors and textures, use your imagination and create a change in the aspect of the car, but don't be exaggerated when you combine colors so it will look perfect for the police car. Add some accessories to complete the attire, maybe some strangely shaped windows. Keep testing your abilities and try to add some innovative aspects to all of your cleaned emergency vehicles.
You need to check out this cleaning game because it has awesome features and you could take a quick look at them right here if you want to identify them:
- Variety of tools and processes to accomplish
- Free and easy to play
- Cool procedure to execute
- Cleaning and designing challenges
- Guidance along the game
- Joyful music and pretty interface
- New abilities to gain during the process
- Funky accessories and interesting styles to adopt
- Replace the broken pieces and renew the whole aspect
- Create a whole new design for a police motorcycle, an ambulance truck, and a fire department car
- Learn the procedure for washing a car
Please wait! Emergency Vehicles at Car Wash game comments loading...
Emergency Vehicles at Car Wash 1.0 Tips, Tricks, Cheats and Rules
What do you think of the Emergency Vehicles at Car Wash app? Can you share your complaints, experiences, or thoughts about the application with Racz Andrei and other users?
Emergency Vehicles at Car Wash 1.0 Games Screenshots & Images
Emergency Vehicles at Car Wash iphone, ipad, apple watch and apple tv screenshot images, pictures.
Language | English |
Price | Free |
Adult Rating | 4+ years and older |
Current Version | 1.0 |
Play Store | com.bmapps.emergencyvehiclesatcarwash |
Compatibility | iOS 6.0 or later |
Emergency Vehicles at Car Wash (Versiyon 1.0) Install & Download
The application Emergency Vehicles at Car Wash was published in the category Games on 14 December 2017, Thursday and was developed by Racz Andrei [Developer ID: 1294722060]. This program file size is 34.3 MB. This app has been rated by 1 users and has a rating of 5 out of 5. Emergency Vehicles at Car Wash - Games app posted on 14 December 2017, Thursday current version is 1.0 and works well on iOS 6.0 and higher versions. Google Play ID: com.bmapps.emergencyvehiclesatcarwash. Languages supported by the app:
EN Download & Install Now!App Name | Score | Comments | Price |
Crazy Mommy Adopt a Pet Reviews | 3.6 | 3 | Free |
Fairy Room Cleaning Reviews | 1 | No comment | Free |
Little Elephant Day Care Reviews | 3 | 1 | Free |
Dirty Airplane Cleanup Reviews | 1.5 | 2 | Free |
Train Cleaning and Fixing Reviews | 3 | 2 | Free |
This app has been updated by Apple to display the Apple Watch app icon.
App Name | Released |
Eatventure | 10 February 2022 |
Supermarket Manager Simulator | 01 April 2024 |
My Perfect Hotel | 29 July 2022 |
Township | 23 October 2013 |
Whiteout Survival | 12 February 2023 |
Find on this site the customer service details of Emergency Vehicles at Car Wash. Besides contact details, the page also offers a brief overview of the digital toy company.
App Name | Released |
Stardew Valley | 24 October 2018 |
Purple Place - Classic Games | 17 May 2019 |
Bloons TD 6 | 14 June 2018 |
Minecraft | 17 November 2011 |
The Game of Life 2 | 15 July 2020 |
Discover how specific cryptocurrencies work — and get a bit of each crypto to try out for yourself. Coinbase is the easiest place to buy and sell cryptocurrency. Sign up and get started today.
App Name | Released |
CapCut - Video Editor | 14 April 2020 |
BeReal. Your friends for real. | 08 January 2020 |
Google Chrome | 28 June 2012 |
Target | 24 November 2008 |
Gas | 27 August 2022 |
Looking for comprehensive training in Google Analytics 4? We've compiled the top paid and free GA4 courses available in 2024.
App Name | Released |
Stardew Valley | 24 October 2018 |
Suika Game-Aladdin X | 06 March 2024 |
Geometry Dash | 13 August 2013 |
Poppy Playtime Chapter 1 | 08 March 2022 |
Bloons TD 6 | 14 June 2018 |
Each capsule is packed with pure, high-potency nootropic nutrients. No pointless additives. Just 100% natural brainpower. Third-party tested and validated by the Clean Label Project.
Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules.
The easy, affordable way to create your professional portfolio website, store, blog & client galleries. No coding needed. Try free now.
Emergency Vehicles at Car Wash Comments & Reviews 2024
We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!
Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!
Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!
Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!