Solar Walk Lite - Planetarium App Reviews

VERSION
2.7.14
SCORE
4.6
TOTAL RATINGS
31,808
PRICE
Free

Solar Walk Lite - Planetarium App Description & Overview

What is solar walk lite - planetarium app? Solar Walk Lite is an astronomical app that turns your device into an interactive planetarium with a wonderful 3D model of our Solar system. Take a trip to outer space and explore the immense scale of the Universe we live in.

Lite version of the well-known space app Solar Walk is absolutely free and contains all the main characteristics and objects of our Solar system.

- Absolutely free: no In-App Purchases
- Small in size
- No Internet connection required
- Easy to use
- Stunning graphics and visuals

What Users say:

"Excellent! First-rate tour of the Solar neighborhood. Don't miss!" - by Hamlet

"I'm fall in love with this app. I love it! Thanks a lot." - by Béymar Háenz

"The best app ever." - by Andrei Satova

"Great app..It is a must have if you are interested in exploring what is outside Earth frontiers." - by Joe Rivers

Main Features:

● Interactive 3D model of the Solar system. Enjoy amazing space view with real-time positions of all celestial bodies.

● Every celestial body is accompanied by its internal structure, extensive information, interesting facts, and gallery with real photos taken by telescopes or NASA spacecraft.

● Orrery Mode on/off allows you to see the schematic or realistic sizes and distances between the solar system objects.

● Anaglyph 3D on/off. If you have anaglyph 3D glasses you can activate this option to navigate through the Solar system and enjoy the beauty of space realms in 3D.

● Zoom-in to see objects in close up and zoom-out to see the position of our Solar system in galaxy.

All 3D models presented in the app are based on scientific data collected by ESA and NASA spacecraft and ground-based telescopes.

Solar Walk Lite offers you:

- Pocket planetarium
- 3D model of our Solar system
- Interactive space encyclopedia
- Exciting way to learn about the Solar system for kids and adults
- Virtual flights through the Universe
- Fantastic view of our Milky Way galaxy

Get a little closer to our wonderful Universe!

😍 Do you love Solar Walk Lite - Planetarium app? Please share your friends!

share facebook whatsapp twitter pinterest email telegram
App Name Solar Walk Lite - Planetarium
Category Reference
Published
Updated 04 May 2026, Monday
File Size 176.85 MB

Solar Walk Lite - Planetarium Comments & Reviews 2026

Best game ever. This game helped me learn a lot about space. I’m trying to be an astronaut when I grow up and it helped me a lot. I’ve been taking notes on the things. I’m gonna see if I can

The best planet app ever. Its great, it makes you pay for nothing. If you like paying you might not like it, but if you dont like paying you should try it because it makes you pay for nothing and you can just get the app. Review by Benny Fine, age 6.

You’re passing the test on this one Alvin. This rendition of the solar system visual representation gives me hope of seeing the future unfold just as it should and was spoken of newly discovered objects that will eventually appear.

I like it but I have some suggestions. Can you add Pluto’s other moons? (Only Nix and Hydra) Add the Oort Cloud (it’s beyond the Kuiper belt and shaped like a ball Add ORCUS and quaoar Add JAMES WEB TELESCOPE! It’s a new telescope Make the sun a little whiter because it’s very light yellow/white And there are some bugs you need to fix: I can see asteroids right through the planets when I view the asteroids from the back of the planet I can also sometimes see the sun through some of the planets so make sure you fix that. I know this is too much but please put this in your ideas of updates.

Super awesome🤩. This game is awesome and I’ve only been using it a few hours. I thought it would be like the other games but this is actually the real thing! I love this game and I’m never deleting this game. Take my suggestion and DOWNLOAD NOW!!!!!!😎😎😎

OMG OMG OMG OMG. So i searched when the iss will be viewed in my area and IT WAS SO ACCURATE! I had another space game and whenever i would look at stars my eyes would BURN. But all the things that are bright (stars and comets) it would not burn my eyes at all! I am obsessed with space and i noticed popular stars (for example vega) are white dwarfs! This is great but one thing. I LOVE constellations and i think that it would be cool to add them! This is amazing in my opinion!!

THIS IS PERFECT FOR ME. I really love space and this is perfect! I love the new update tho :) and I wonder if there can be one were it shows all things like other galaxies, and black holes, and the whole universe! But that would be...to much to work on...ANYWAY this is beautiful the earth and moon look MUCH detailed and yeah! This is the best space app I’ve got

Great definitely recommend it. This game makes you think and at the same time like you have fun. definitely recommend this game for kids and even adults. It’s great and you get some exercise.

A review. This app is used by many for educational and entertainment purposes, and to help with this I would like to point out something. Ganymede is smaller then Io. (lo?) I feel like the 3D planets and moons should be as accurate as possible. This is something you creators should fix. Also on a aside note the stuff scares me? Idk why it just does.

How solar walk life works. Well if you tap on a planet and you hit the j button there will be all kinds of little tabs were you can click on and there is a tab that shows a little star frame and you click on it it will show you pics that were taken on that planet there is a tab above the the little star picture frame if you click on it it will show you the endercore of whatever planet you choose to click solar walk life is awesome you have to get the app man or women you have to get it!!!!!!!

Amazing / detailed 😁. Best outer space 🌌 game I have ever played it’s cool and amazing I love the way you can see real pictures of the planets🌎 moons 🌙 or comets ☄️ and I love the way you made it so we can see their crust mantel outer core and inner core it’s so cool I love outer space and I’m really into Austrian I’m really into astronomy 🔭 space is my favorite theme ☄️☀️💫⭐️🌟✨⚡️🌗🌘🌑🌒🌓🌕🌖🌔🌎🌍🌏🌙💥🌞🌝🌛🌜🌚 🌌🌄🌅🌠 so so cool if you get this I hope that you feel the same way :)

I like it. So I like astronomy water simulations etc and this is perfect but here’s one thing so on your other solar walk I got (if im correct) I got some of the packs and they didn’t work I tried restoring them and even that didn’t work also one more thing WHY IS THE SUN SO BRIGHT MY GOD

This game needs some fixes now developer please fix the game. This game doesn’t have that much stuff but also they should add more galaxies more stuff more detail to the Milky Way because there’s not that much places to go in Sagittarius a looks kinda good but not that good

This game is so educational for a little kids😍. So recently, I just played this game and it was so much fun and this seems an educational game for little kids like 3+ ages and it’s just really fun to play you can have fun with your toddler I mean, like I have a toddler and after this review, I might show this to my little baby toddler note to developer. Thanks for making this game. This is super educational and really fun for kids. I mean kids can imagine what it’s like walking on different planets. You know you make so much good games just just saying that OK hopefully you have a good day or if you’re reading this at night good night

This game is greatly designed. This game has good graphics and very cool I have one suggestion that you can try and make more galaxies and if you fail you can give up and try other suggestions from other people or you can try and try because I have high hopes that you can do it. And I seriously like this game

I love it!!! But please add black holes. When I first saw this game it was amazing but it was missing something…black holes!!! I honestly love black holes so can you please add some black holes in this game also to make it more interesting but otherwise the game is still amazing.

Truly a beautiful app. I have PTSD and sometimes my anxiety is unbearable, but this app allows me to focus and regain control. Something about jumping from planet to planet or just watching a moon orbit a planet is just truly beautiful. Love this app and will be buying the paid version on payday!

Some more stuff in game. PLEASE READ PLEASE READ PLEASE READ PLEASE READ. Some things need to be in the game, The only thing I can say that is shortened to make it very simple, Just add everything that Solar Walk 2 has, also Star Walk 2. please read.

Wow. This app is beautiful. I love science and studying astronomy, this app has it all. The planets and stars look amazing, and I love the fact that you can view the planets structure. We need more apps like this to educate people. Thank you

SOOO GOOOD. when I start playing this game, I thought it was a little good, but when I start start playing it more I thought it was really really good and then I start making videos about it and then I got 1 million LIKES but I wish you would add galaxies so it can be really really cool and fun and so interesting cause it’s my dream

Love for the solar system right now ❤️. OMG!!!!!!!I just got this app and it’s amazing, I love that you get to see Pluto and learn/get to know facts about them. If you like the solar system and you don’t want a game that will BURN your eyes out, I would recommend this app. It will give details and show you what Wikipedia says about it, the app tells you how it got its name, and so much more. I want my brother to use this app when he gets into the grade I’m in right now, I think this app helps many, many, MANY people understand facts and learn so much about the planets. The adds don’t pop up as much as my other apps do, + they will still play the music while the add pops up so you won’t have to listen to loud, I mean LOUD music/voices from your device. Overall, I would suggest this app for people that are interested/learning about space in school it will really help with their education 😁.

AMAZINGGG😍😍😍. I love this game I’ve been playing this game for 3 years and it’s my number one game u can literally choose if u like want ads or not and it’s free. The other games like want u to pay for no ads but this onesFREEEE DEFINITELYGET

Great App, bad ads. I would give it 5 stars but the ads are obnoxious. My kid loves the app but the ads are relentless and take forever to click through. Trying to close and ad routes to the app in the App Store instead of back to Star Walk. I have also witnessed very inappropriate ads for kids. I wish I could just buy a no ad version. For now I have to uninstall it.

I LOVE THIS APP ❤️. I LOVE THIS APP SO MUCH!!!! It gives you a accurate model of the complete solar system. I am a FAN of astronomy, and wanted a app that shows me a model of the solar system. I found this app and instantly fell in love with it! 100% recommend!!

PLEASE ADD THIS!. I love the Music 🎵 and please add more music 🎶 to listen to. And just please add a mode to explore the andromeda galaxy 🌌 and make made up planets 🪐 and stars ⭐️. Don’t listen to the haters because they want you to remove the music 🎼🎵🎶. Have a great day 🙂🌪️!!

Good for teaching basics 🙂. My uncle got ipad when they first came out, and this is one of the apps he installed. Still love it! Although not as awestruck myself, looks great for teaching young kids about which planets are where. I like the option of having planets closer together or at realistic distance. PTL for this app!

The best game ever no mistakes❤️❤️❤️❤️❤️❤️❤️. Hi I love this game there is nothing wrong with it I will tell you why I love it 1.no add interruption 2. no interruptions to rate the game 3.you do not have to pay for anything 4.you can zoom out really far 5.you can se planets,comets,satellites,and dwarf planets love the game a lot ❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️😁😁😁😁😁😁😁😁😁 keep up the great work

This app is amazing!. I enjoy this app very much. I can now show my siblings the planets in 3D. Although I am not 100% sure but The planets might not be where they are in real life, But I am not sure. It is an amazing app! If you like looking up at the stars this app is for you.

Cool app but theirs something wrong with it.... Thank you for making this app! But when you fast forward the time nothing actually happens. I want to see what happens to the solar system in the future also when I reverse the time to bc theirs still light on the city’s please make this more realistic

Great but. So it was amazing five stars but I wish you could also look at the other universe(s) the have been discovered because it would make the game a little more fun Than it is right now so yea just add dat plz

A different view. This app is awesome, if you want to see a different side of the galaxy we live in from the other apps this is for you, I have always wanted to be able to see the location of certain asteroids and all the different satellites that orbit the earth and with this app I like to track when something will next pass the earth and I could see it! Love the app! 5/5

Loving the app. I am so obsessed with space and this game is so amazing just to look at all the planets. I don’t own a telescope and this was amazing. I just get to look at the galaxy which I study on. This app is 5 billion stars! You guys are so amazing I can look at that app all day! Keep up all your good work! You make the App Store 100% better than it already is! Maybe even 500% better! I go on that app everyday! Well keep up the good work!

It was good but you missed somethings. Can you please add MakeMake's moon mk2 and add dactyl to the astroid Ida? That would make my space 🚀 studies much easier and it would make me happy 😊 and can you please add orcus and quaoar and 2014uz224 and can you please fix io's size cuz it looks bigger than Ganymede! Oh and please make Sedna pink not orange other wise I love the app! 😎🤗😍😅😂🤣😀😃😄😁😆😛😝😜😋😏😼😺😸😹👍🏽👍🏽👍🏽👍🏽✌🏿

It’s so fun but a little bit of ads. You can explore to the moon even the galaxy but I was looking at the galaxy a ad popped up my screen and it took 30 seconds to stop and it was annoying me

Question. My kid absolutely loves this app, and I do too. Is there a premium version? I understand ads are your main source of income, but they are quite annoying. Even worse, there’s no option to remove them by purchasing the app. I reviewed your other apps, and Solar Walk 2 doesn’t seem to be the same as this one. Am I wrong? Could you please consider creating a premium version of this app? Thank you!

Best solar walk app you can get!. Ok So I got this game about 3 years ago and I thought it was good and it was. I think you should add more languages like Korean. And please add like 2 - 4 more galaxies and probably the universe BTW I LOVE YOUR APP BYE (please respond and please add the things I asked for)

This game is the BESSSSSST😃😃😃😆😆😆😆🤣🤣🤣🤣😍😍🥰🥰😍😍😍. It’s the best game in the world! There’s so much things you can do the animals about the crying and it’s so crazy so crazy it’s so crazy to crazy. I can’t believe they made this there’s the best people in the 🌎. I can’t believe they are the best people because there’s so much detail added into this then it’s just exploding my mind! from earth to Mars to the sun, to comets to stars, to asteroids to whatever it’s just the best thing in the world. and I do not understand why there’s so much detail you could even go onto other stars not just the solar system. Saturn is so many details, and other planets like they look so alive like you could see the internal structure or look about the Wikipedia any about it’s true thing like the sun is not actually yellow it’s white it’s crazy… but sometimes I get bored but that’s nothing it’s just because I do you know do too much of the same thing but still, I have feedback what if we can just zoom out until the entire universe is finished like they already discovered other galaxies, so why not well maybe not the entire universe but maybe that like why not like can you shut the galaxy like it would be better if I could see other galaxies too. I mean, that would be amazing if you could see other planets like that gas giant that’s in earth place a.k.a just right orbit. that would’ve been cool. But again, thank you for this amazing amazing game. I don’t know what I would do without it!!!👋👋👋👋👏👏👏👏😀😃😄😁😆💵💵💵💵💵💵

Great App To View The Solar System and Planets. I wish there was a way to fix the view as a “top down” view to see the planets orbit the sun without having the view plane being “tilted”.

Good astromany app but less too explore. This app is great for learning what the planets look likeand new objects out there! But theres just one thing missing.. why can you discover galaxys? Like not just are galaxy.. why cant be discover other galaxys?? I love the app very great app you got!!(please respond)🤗🤗🤗🤗😁😁👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍🤗🤗🤗

Oh my. Just when you open the app and the frame zooms into the solar system and focuses on earth... Wow. Really puts into perspective how far apart the objects in our “neck of the woods” are. You can instantly focus on the sun from the earth when the suns light takes eight minutes to reach us! Mind blowing

ABSOLUTELY AMAZING BUT MISSING ONE THING :(. so this app is absolutely amazing, it gives so much information and makes it someone fun to look at these planets in 3d- especially with the good quality. but it's missing one thing, for each planet there is a section where it shows the internal structure of the planet, it's super cool being able to see inside of these planets, but it would be so much better if you listed what those layers where made out of, like show what material the core is made of and the crust, or i might just be missing how to, besides that, it would be super awesome if you updated that, but overall such a great app

One thing I can’t do. I really like this game but there’s one thing I can’t do I play this game every day but I just won’t let me explore the Milky Way so if you can make it so we can explore the Milky Way I will leave a 5 star so please make it so that I can explore the Milky Way ok I really like this game that’s the one thing I can’t do witch is explore the Galaxy bye.

0/10 more ads than things to do.. A few days ago I decided to install a few Solar System apps. Some apps go above and beyond. Not only am I able to check out the planets in our solar system and basically everything else that we know of, I’m also able to visit a lot of other stars and their planets. This app unfortunately isn’t one of this apps. When it comes to our solar system, there are a lot of missing dwarf planets, comets, TNOs, etc. I was able to visit a limited number of stars, but that was it. I wasn’t able to check out their solar system. You’re also not able to click on anything outside the solar system. I actually didn’t try to click on everything in the solar system so I might be wrong. You have to look up the distant star then you’ll be able to check it out. Compared to other apps, there’s not much content or anything to do. Worst part is that there’s a non stop supply of ads. You can’t skip these ads, they last 30 seconds, and after, you have to wait 5 more seconds before it transfers you automatically to the App Store. Every 2 or 3 minutes, ads. If you look something up, ad. Go back to earth, ad. Settings, ad. Felt like half of the time I was forced to watch ads. I know I mentioned ads a lot, that’s this app. There are plenty of better apps that don’t show you ads every time you do something.

Finding planets. I love using this site to find planets to take pictures of In the sky. It takes the guesswork out of finding where they at.

I love this game. Here is my suggestion, can make it to where I can explore the universe,galaxies, planets,solar systems, and everything in space. I really love this game I love space so much, thank you for creating this game!!!

I have recently decided that this is not the best app.. I have decided to delete this app since I have had a bad experience. I have to admit that I will never again use this app since I am absolutely disappointed with the ads every single time I have done a few things. Please understand that I am absolutely disappointed with the way this app has been treating me whenever I use it. I just get started, do a few little things and...poof! There’s an ad! And that is why I have deleted this app since I have been disappointed with it recently! I WILL NOT SPEND MONEY ON THE PAID VERSIONS OF THESE APPS! I have better things to spend my money on.

An amazing game. This is a great game and I love to see the planets although there are 2 things that would make it better 1 putting the planets sounds when you tap on them and 2 it would be amazing if you could see other known solar systems/parts in the Milky Way but other than that it is an amazing game that I highly recommend to fellow space lovers.

LOVE IT😆😆😆!!!!!. I’m a big fan of space and I really wanted a space app. Until I discovered this app and decided to download it. And OMG!!! I LOVE this app! I love that you can discover planets, asteroids and dwarf planets! I was surprised that you can see all about them! Even photos. I was surprised that I could see the galaxy and our sun! I recommend this app! 5 stars!

Update (New Game). Add Country borders on the earth and make a mission launching on any object so that the game looks good, add an new game called "ages of domination simulator" so u gotta add any of the maps of the world and add nukes,missles,troops (Army sizes) and add scenarios and make guns for troops (NO BLOOD) even add nation names and a chat box so that the countries can chat (Filters: Swearing/Violating/Insulting/Bullying turn all of them to rags if anyone tries to break that rule of the chat, so the game is safe for children pls make the new game i promise. Wil rate it 5 stars so good luck, read carefully tho

Cool app but two problems. It’s a cool app in all. I like how you can see the planets and the sun in super detail. but I wish you didn’t have to buy some moons and all spacecraft. And I wish the app would help you tell if the core of a planet was solid or molten.

💰 A universe of opportunities: Payoneer

Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!

I love it but... I love this game but I don’t have this game but I still love this game

Good work. Can you make more games like that this

Your app. Just a thought to orbital lines being a little more prominent would be beneficial apart from that it is amazing!

Good, but needs more. Hello! This is a really cool app! It is also very fun to use, and it is easy to use too! I was wondering if you, the creators, could add a bit more. Like maybe the galactic centre, but or beyond the milky way galaxy. I already know many things about our solar system and beyond, but still you should add stuff past the Milky Way. No pressure! Thank you and good job on the great app!

Great. I I’m so interested in space and this game is awesome I love how u made it and it has so much information I’d love if could zoom out even more so u can see all galaxies and clusters also if u could add black holes that would be a dream thanks for making it I hope u read and reply

Awesome 🤩. I think it is totally awesome 👏

Wow. Helps me so much at school thank you

299792.458km/s. This is awesome, I love it. Well done to the creators of this app👍👍👍

Omg 😮 amazing 😉. I have been looking for a good solar system app|game to use and I finally have found it this game is amazing keep up the amazing app One small suggestion : When you click on a planet it gives you facts at the bottom of the screen and I have been finding out a lot of things about the planets but could you please put them in order cause I am reading the same things all over again Thanks for your time hopefully you will listen 👂 to my suggestion thanks 🙏🙂👍👍

Dfghvc. Fdgvfhjvftvdgb vjc v. gffhhgfhbcbvgggggghytggfhgbgghjjhhhmkgfhfdyhfrgfdfgfthgryvvnkkkgvdnvghchnbv

In my opinion. Every thing about solar walk is amazing I am pretty sure there is nothing bad about the facts are really informative it helps me with my science 🧬 at school we are learning about solar walk it has been the best experience and I just downloaded it yesterday

It’s amazing how you can see everything including space ships and stations and rovers very epic. E

Nothing wrong. Everything goes great and if that’s not enough it tells you when exiting things are happing

Solar walk. Great app. Informative

Poo. It is poo

Fantastic!. I like the planets but I don’t like the adds as much. I love the art and the satellites because they usually are in-app purchases and upgrades as well. I recommend this for stargazing lovers!

BEST APP EVER. OH MY GOD this app is the best the 3D mode is so cool thank u for making this 🤣🤣🤣🤣🤣🤣🤣🤣🤣

🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏. This app is my 5th best app, which is not bad, also, it has no bugs! It is so awesome! I can’t wait to play it again! to: 🌏solar WALK lite🌏

Moon. The moon does not rotate.

AWESOME. This game is awesome if the owner of the game is reading this please put in maybe like black holes or something :)

Interest. Something coming up with Rock might hit to earth some day. See new Plant more coming and one day close to earth to see many plants make earth feel scare to close and see lot plant around!

Almost stunning. This app is wonderful! I would give it 5 stars if only it was not interrupted by annoying and inappropriate advertisements. I guess that is the price to pay for a free app. Maybe you should consider charging a modest purchase fee for this app and remove the ads. I would pay for it. Cheers. Hazing

School kids love it!. I use this with my Yr 5 students.It’s free, yet provides relevant, interesting info. Wishlist: It would be able to mirror/project on screen more clearly.

Planet view. It would de really cool if you could see from earth while skipping time because the stars will be going around and around and around and around until it stops

Absolutely gorgeous. Amazing app. Thank you.

Eiddon. Excellent I really enjoy it Thanks

So good!. This app is really helping me in school, also this app is cool. This really helps me because right now we’re learning about space

Fun Game🌕🌖🌗🌘🌑🌒🌓🌔🌕. I love it and so cool 😃

Solar lite is awesome!. In this app I have learned lot’s of cool stuff about our universe, keep up the good work Solar lite creators!!!!!!

It’s cool. Three words I love it Wait is I a word?

⭐️⭐️⭐️. Amazing app for free! Thank you Developers! Awesome work! My son is 3 and he’s in love with the Solar System. He Loves this app.

Solar Walk Lite. Go get this app and visit titan And the rest of the planets Truly brilliantly awesome thank you so much

I totally like this. This is absolutely amazing this is 10/10 I’m so amazed and impressed I am impressed about the sun like how did someone know inside of the sun this is absolutely scientific keep up the good work

🧠 Join the movement! Experience the world's No.1 brain supplement

Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!

Great but needs more. This game is really fun except the controls are really hard, you should add free movement so yo don’t have to rotate around something all the time, there should also be more stars like the centauri or some famous star clusters and nebulae, If you want to add more depth to the game you could also add ai generated planets and stars, other systems that again can just be ai generated, and in the future you could even add other galaxies, thank you for taking the time to read this, I would love this I really appreciate it, and it would be better if you would add some of my suggestions in to the game, cheers -Mathis

Love it !. It’s really cool to see all the planets of our solar system p.s very good graphics!🤗

I love it it teaches me about the solar system, which I really want to know about. So yeah, I love it

By Chris. Finally i downloaded this game — Haha, that review was made by my younger brother. He’s learning so much from your wonderful app. Keep up the great work! :)

Awesome. It's so cool nothing to fix

So much fun. This is so much fun I am learning so much

I Love The App. This Is One Of The Best Apps Ever. Will There Be Any New Features?

Please get right nooooowwww. I love how you update so fast unlike the other apps

Our earth in the solar space..!. I love to find my home in 🌟God’s creation !

…. i love it but WAYYY too many ads.

Super app. If I had that app when I was a kid I'm certain that I would have been an astronaut (stupid me went in to network management). Great app and the three dimensional view is spectacular. The viewer gets a sense of the magical mystery of the gravitational danse of planets and the moons they entertain.

Game game. It is a good game but I wish they had more galaxies and more but over all its good

best app. You are the best!

moon two earth 2017. moon two earth 2017

A diaphanous app that elegantly displays 3D illustrations of the universe around us. A diaphanous app that elegantly displays 3D illustrations of the universe around us This is one of the few times I’ve been forced to write an app review for an application that is so well-developed. I truly believe that by understanding the concept of space and time, humanity can be freed from its myopic vision. During my lectures, I’ve tried for years to explain astronomy of the world around us in 2D diagrams wishing there was an interactive 3D model I could use. This app is exactly what I was looking for and will be a great aid in my teaching. To the developer: can you please create a version that explores the observable universe as we know it? I, as I’m sure with others, will gladly pay for that app. Thank you for considering.

Mauvais fonctionnement.... Impossible d’ouvrir l’application! Elle reste sur le titre et la musique. Que faire? Louise Rivard

Space. The final frontier

Well done!. I thought this would give my 4 year old son a good view of the scope of our system and not much else. I couldn’t be more wrong, this app showed him that and so much more. I have to pry it from his hands just so i can try to keep up with him. He loves it so much he asked if he could bring it to his school and show everyone the planets. Well done, we have already spent hours going from planet to comet to satellite and back again. Keep up the good work!

Great game. Hello, this game is really fun but to make it even more fun can you add more galaxies please?

Best Game ever!. Thanks a lot for making this, im 10 years old and love space/solar system and astronauts. This keeps me very entertained. But also could you had the black holes? If not it’s totally fine! Great game 10/10

G00D GAME 🤣🤣🤣🤣🤣. I love this game it’s so cool and it’s so fun and I like planets all of it it’s just the best😄😁🥰😍😘😋😛😇🙃🙃🤣😅😇😘😉 I love this game

Incomplete. Even if you don’t have data, the updated actual bodies should be displayed. The only moon shown with Pluto is Charon.

Improvements. "pan" and directional control while in planet selection could use some help. A little more educational and dynamics info in the highlights could be nice

Bug... The app won't start. The app starts, but I only see the Solar Walks and the music in the background and it stays there... Please fix

I’m good to see how you doing this is great to hear. Hi this message was so nice

Espace. C’est très cool! Merci de l’application ☺️

I like this game. I’m really interested in this game. I wonder if i could bring it to school tomorrow to show the kids to see the universe.

Ok. Nice graphics but kinda boring. Few seconds later an app comes out

Brilliant app. Love this app. Good write ups and fun interesting graphics👍🏼

Good app. Space

Bravo. Bravo votre application explique toute la galaxie et mal aidée à m’endormir pour la première fois et il m’a suffi de regarder les étoiles merci

Magnifique. Très intéressant, belles photos et les informations sont complètes.

Average. The game is all about the solar system,the drawf planets and the space telescopes but it’s not all of the universe and galaxy

Great!. I really really love astronomy. I study it, I have a bunch of stuff like A planetarium, constellation nightlight, all sorts of stuff. And this game is so nice!! It gives me a bunch of facts and stuff and it’s so cool.

Very good. Very very good

Nice.🙂. Solar walk is a bit like 100000 stars, it’s a really good app. But I expected better graphics though...mainly when zooming on to astronomical objects, and the comet tail animation effect.

Good game!. I really like The game I think it’s awesome, it’s amazing how much detail you guys put in it!!! 🌏🪐✨

Amazing 👍🏻👍🏻👍🏻. This app brings back the memories of when I was very interested in sky science and solar system! It’s so educational! The song is relaxing! I would 100% recommend it! Wish I could give 6 stars! Well done, keep up the great work!

Pretty cool!!!. Love it!

Good game. It’s good but too many ads and doesn’t cover most of the stuff I want to see

Great 👍. I am happy I’m learning the solarSystem

👉 Are you looking for an Adsense alternative advertising platform?

Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!

Heaven and more. This is so great! I was learning so much about this app!!🤩but you need to add one more thing explodes planet going in a planet Heaven but keep up the good work this knows everything!🤩🤩and like learning to🧐🧐great app!😃😃😀😁😁

Good, but some issues. When I got it on my phone, I used it already. There’s some money of it that makes It good but for others under Sixteen or Sixteen yes old, the money is bad. Thanks!

Uv. Great app for those who enjoy the galaxy. You can zoom in and out plus has a background music.

Love this app.. ; i’ve always been a spaceman especially around seller system this app really brings the solar system much closer and I really like that

Love it!!!. It has everything you could want and more in a view of the solar system. The detail of the planets are wonderful. Keep it up!!!

Not Really. Didn’t Even Have To Play. Here’s Why.. When I downloaded this game, I realized after getting in the app and waiting for a few minutes the app just stayed black so I had to delete the app for space and because it was pretty much useless. This needs to be fixed in order for me to download it again. Awaiting response.

Love it. This game is so cool I can see what’s on top of me it’s fascinating best game ever played all my life I love this face game it’s so cool I wanna play it every single day it’s so fascinating it’s so cool I love it cool fascinating great amazing awesome game🪐☄️💫🌕☄️🌕🪐💫🌞

This game is the best download it. I got some Pangea NFI just went backwards in time enough I would see Pangea

Review. Honestly it’s pretty good, the only thing I don’t like is: it only is the solar system & some stars

Good app - Constant inappropriate ads. Loved the app features. Hated that my six year old is forced to watch inappropriate ads constantly.

Amazing app!. Wow! I love the detail and the asteroids that you model so well! The ads are so minimal and this makes for a good app! I love the detail and the moons around Saturn! Thank you guys ( creators ) for a good app!

Awesome. This is a very detailed game with accurate settings. This app is full of wonderful features and information.

To many adds. I love this game but it has to many adds can u make this app without adds but over all this app is great

Nice app. What a great little free app, I wish more apps would give so much enjoyment instead wanting money and giving us less fun.

Very good. This game is very realistic with planets and moons and beautiful graphics and the ability to view satellites above Earth. Highly recommend.

From me to you.. Great to zoom in on all the planets. Be nice to have the doe so we can start landing and populating the planets 🌎galaxy and onward. Love ❤️ the app.

Providing an honorable service. I have nothing but positive words, it is a very solid app. Consider your investment!

One of the best app!!. Even a expensive app, doesn’t have the way this app allow user to navigate inside it!.

About in space. I love space but can u male and updated to make A lot of galaxy please

Just add some more exploring. It is a really good app, but just add like, going on planets and see images of them that’s the only thing you need to fix.

Cool. This is a very great app. The only thing is that I wish we could go inside of the ISS. But marvelous app and great graphics. Love this

Solar walk app. This app is the next best thing to being in space. My favorite by far of all apps!!!

Cool but now boring. It’s a little boring now, but I’ve got to tell you, before it was very educational and fun, but all you can do now is just go to the planets and go backwards in time so that’s why I gave you a 4 star rating instead of a 5 star rating

OMG LOVE IT, but... I love this app! But I wish you could zoom out more, and find new suns, planets, and stars! Another thing is, it could show us comets, asteroids, and rockets! Thank you for taking your time to read this.

Fascinating Review of the Solar System. An excellent app with a variety of features -- gorgeous 3D plus basic info at your fingertips And a link to Wikipedia for additional info on each planet. Highly recommended.

Awesome. No purchases or glitches so far and fairly little ads great game I highly recommend.

The Impossible. I’ve never had more fun in my life. The planets are so beautiful.I’ve always dreamed of being in space.

Best game ever. This can help me learn about the solar system and more I didn’t know I love it already

Overstanding myself.... An excellent way to understand the stars and planets made of the same stuff that we are. I’m simply star dust in my own solar system...

Great App!. I really enjoy this app! I love space and it is super cool to be able to explore it. There are many things to look at and you can even explore moons of planets. I love it!!! I recommend it 100%!!!!

It’s good. I like the game, but you could add some more dwarf planets and moons, and different solar systems It’s still good tho Also make it where you can land on planets

I’m satisfied!. If you’re curious, or if you’re just bored, this app is a lot of fun to just explore our solar system. It’s crazy how many moons Saturn has!

Big win!. My 8 year old son has autism and he loves this app. He knows everyone by memory. He zooms in and out of the galaxy and just gets a real kick out of it. 👍🏻

So Interesting. I have long enjoyed looking at stars without a telescope and know planets don’t twinkle. 😂 Seeing colorful orbiting planets is fascinating and I’m thanking YHVH for His Creation.

Beautiful!. Since I was a bit younger I loved this game and now today well I’m reviewing it and I love you hope you love my message!🌈❤️⭐️🌟✨🍬

I hate this game. All you can do is just look at the solar system and I can’t explore the universe. I was sad that I can’t play space engine so I was looked on the App Store and saw this game, so I thought it was gonna be some really similar but all you can do is just look at the solar system

The graphics are too great. The graphics are SUPER great, keep up the good work! I like learning about the solar system so this game is a guaranteed exception

This app I can see what the world look like. I like how you can do everything

love it. I really like the app but i have an idea: it would be nice if you can explore exoplanets because whenever i go to another sun it doesn’t show exoplanets so it would be really nice if you add exoplanets

Ads are finally a deal breaker. It's funny that the latest version claims kid-friendly ads, because it just showed my son a naked person on an operating table. The number of ads in this app has always been ridiculous (more than one every minute) and now that they're going to be age-inappropriate, I'm done

Too many ads. Every time I try to navigate back a screen, it is popping up ads. It gets to where you can't do anything without an ad showing up. Annoying. I would rather pay for something that works smoothly.

Fun game. It’s a fun game and it helps you learn about space you can even look at comments I learned some things that I never knew so you should try it

Amazing. This game has so many stuff to learn about in space I love that and also I’m a fan of space so I know that this is awesome I mean the ISS Hubble space telescope sll of thst awesome stuff just incredible!

Amazing app!. it’s so cool you can zoom in and out and look anywhere in the galaxy and you can see the satellites on earth to! It’s soooooo amazing From Soren.

Best app ever!. Great job! I do not experience bugs or glitches! I love how you can interact with all the planets,moons and the stars! This is very educational! I recommend this for youngsters and people who likes science!

Star gazing. I love this simulation. You can see almost anything in our entire souler-system. it’s like star gazing!

Live it but change one thing. I love this game but I want to enjoy this game on my computer so can you make it so that you can get this game on pc to

Amazing App. Every space lover should have this app. Amazing graphics and easy to use. So glad I found it!

Awesome app. My 3 yo son loves this app. He gets really excited about the animations and me read the tremendous wealth of knowledge that explains each body in our solar system. Kudos to the developers, very well made space educational app!

Stop being mean. I LOVE THIS GAME I have to suggestions. But I wanna say one thing I love this game I have only have had it fo 5 min and I love but haters stoop being mean at least be gentle people work hard on this agian I love it keep working I love it ❤️🧡💛💚💜🖤🤍🤎😍😍😍😍🤗🤗

Please wait! Solar Walk Lite - Planetarium app comments loading...

Solar Walk Lite - Planetarium 2.7.14 Tips, Tricks, Cheats and Rules

What do you think of the Solar Walk Lite - Planetarium app? Can you share your complaints, experiences, or thoughts about the application with Vito Technology Inc. and other users?

solar walk lite - planetarium iphone images 1
solar walk lite - planetarium iphone images 2
solar walk lite - planetarium iphone images 3
solar walk lite - planetarium iphone images 4
solar walk lite - planetarium ipad images 1
solar walk lite - planetarium ipad images 2
solar walk lite - planetarium ipad images 3
solar walk lite - planetarium ipad images 4

Solar Walk Lite - Planetarium 2.7.14 Apps Screenshots & Images

Solar Walk Lite - Planetarium iphone, ipad, apple watch and apple tv screenshot images, pictures.

Language English
Price Free
Adult Rating 4+ years and older
Current Version 2.7.14
Play Store com.vitotechnology.SolarWalkLite
Compatibility iOS 15.0 or later

Solar Walk Lite - Planetarium (Versiyon 2.7.14) Install & Download

The application Solar Walk Lite - Planetarium was published in the category Reference on 26 November 2016, Saturday and was developed by Vito Technology Inc. [Developer ID: 289641503]. This program file size is 176.85 MB. This app has been rated by 31,808 users and has a rating of 4.6 out of 5. Solar Walk Lite - Planetarium - Reference app posted on 04 May 2026, Monday current version is 2.7.14 and works well on iOS 15.0 and higher versions. Google Play ID: com.vitotechnology.SolarWalkLite. Languages supported by the app:

CS NL EN FR DE HU IT JA KO PT RU ZH ES ZH Download & Install Now!
Other Apps from Vito Technology Inc. Developer
Solar Walk Lite - Planetarium App Customer Service, Editor Notes:

This update focuses on a major engine upgrade and refreshed core libraries. Enjoy exploring the Solar System? Please leave a rating and review — it really helps us grow. If you run into any issues, please contact our Support team (via the app’s Support section) and we’ll help you out.

Best Free Reference Apps List

Find on this site the customer service details of Solar Walk Lite - Planetarium. Besides contact details, the page also offers a brief overview of the digital toy company.

Best Paid Reference Apps List
App Name Released
SkySafari 22 December 2017
MyRallyCoach 18 January 2023
KRSUOR 11 November 2022
GoSatWatch Satellite Tracking 22 December 2008
Sibley Birds 2nd Edition 15 November 2018

Discover how specific cryptocurrencies work — and get a bit of each crypto to try out for yourself. Coinbase is the easiest place to buy and sell cryptocurrency. Sign up and get started today.

Top Free App List
App Name Released
TikTok 02 April 2014
Gas 27 August 2022
Pinterest 28 April 2011
Gmail - Email by Google 02 November 2011
Google Maps 12 December 2012

Install the Giftmio extension for smart shopping. Get notified about cashback opportunities, activate cashback in one click, and save money on purchases.

Top Paid App List
App Name Released
Incredibox 27 March 2016
Ouros 14 August 2024
Balatro 26 September 2024
Earn to Die 2 20 November 2014
After Inc. 26 November 2024

Each capsule is packed with pure, high-potency nootropic nutrients. No pointless additives. Just 100% natural brainpower. Third-party tested and validated by the Clean Label Project.