Solar Walk Lite - Planetarium App Reviews

We transfer money over €4 billion every month. We enable individual and business accounts to save 4 million Euros on bank transfer fees. Want to send free money abroad or transfer money abroad for free? Free international money transfer!

Stop being mean. I LOVE THIS GAME I have to suggestions. But I wanna say one thing I love this game I have only have had it fo 5 min and I love but haters stoop being mean at least be gentle people work hard on this agian I love it keep working I love it ❤️🧡💛💚💜🖤🤍🤎😍😍😍😍🤗🤗

Awesome app. My 3 yo son loves this app. He gets really excited about the animations and me read the tremendous wealth of knowledge that explains each body in our solar system. Kudos to the developers, very well made space educational app!

LOVE IT😆😆😆!!!!!. I’m a big fan of space and I really wanted a space app. Until I discovered this app and decided to download it. And OMG!!! I LOVE this app! I love that you can discover planets, asteroids and dwarf planets! I was surprised that you can see all about them! Even photos. I was surprised that I could see the galaxy and our sun! I recommend this app! 5 stars!

Alexander's Review. It is nice and educational but has creepy background music. Please take out the music. It makes me think of a creepy documentary I watched. Thank you for reading my review and I wish you would edit it. Actually, I still here it right now. TURN IT OFF!!!

The best planet app ever. Its great, it makes you pay for nothing. If you like paying you might not like it, but if you dont like paying you should try it because it makes you pay for nothing and you can just get the app. Review by Benny Fine, age 6.

Truly a beautiful app. I have PTSD and sometimes my anxiety is unbearable, but this app allows me to focus and regain control. Something about jumping from planet to planet or just watching a moon orbit a planet is just truly beautiful. Love this app and will be buying the paid version on payday!

This app is amazing!. I enjoy this app very much. I can now show my siblings the planets in 3D. Although I am not 100% sure but The planets might not be where they are in real life, But I am not sure. It is an amazing app! If you like looking up at the stars this app is for you.

Great App!. I really enjoy this app! I love space and it is super cool to be able to explore it. There are many things to look at and you can even explore moons of planets. I love it!!! I recommend it 100%!!!!

Amazing / detailed 😁. Best outer space 🌌 game I have ever played it’s cool and amazing I love the way you can see real pictures of the planets🌎 moons 🌙 or comets ☄️ and I love the way you made it so we can see their crust mantel outer core and inner core it’s so cool I love outer space and I’m really into Austrian I’m really into astronomy 🔭 space is my favorite theme ☄️☀️💫⭐️🌟✨⚡️🌗🌘🌑🌒🌓🌕🌖🌔🌎🌍🌏🌙💥🌞🌝🌛🌜🌚 🌌🌄🌅🌠 so so cool if you get this I hope that you feel the same way :)

Good astromany app but less too explore. This app is great for learning what the planets look likeand new objects out there! But theres just one thing missing.. why can you discover galaxys? Like not just are galaxy.. why cant be discover other galaxys?? I love the app very great app you got!!(please respond)🤗🤗🤗🤗😁😁👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍👍🤗🤗🤗

One thing I can’t do. I really like this game but there’s one thing I can’t do I play this game every day but I just won’t let me explore the Milky Way so if you can make it so we can explore the Milky Way I will leave a 5 star so please make it so that I can explore the Milky Way ok I really like this game that’s the one thing I can’t do witch is explore the Galaxy bye.

OMG OMG OMG OMG. So i searched when the iss will be viewed in my area and IT WAS SO ACCURATE! I had another space game and whenever i would look at stars my eyes would BURN. But all the things that are bright (stars and comets) it would not burn my eyes at all! I am obsessed with space and i noticed popular stars (for example vega) are white dwarfs! This is great but one thing. I LOVE constellations and i think that it would be cool to add them! This is amazing in my opinion!!

THIS IS PERFECT FOR ME. I really love space and this is perfect! I love the new update tho :) and I wonder if there can be one were it shows all things like other galaxies, and black holes, and the whole universe! But that would be...to much to work on...ANYWAY this is beautiful the earth and moon look MUCH detailed and yeah! This is the best space app I’ve got

Love for the solar system right now ❤️. OMG!!!!!!!I just got this app and it’s amazing, I love that you get to see Pluto and learn/get to know facts about them. If you like the solar system and you don’t want a game that will BURN your eyes out, I would recommend this app. It will give details and show you what Wikipedia says about it, the app tells you how it got its name, and so much more. I want my brother to use this app when he gets into the grade I’m in right now, I think this app helps many, many, MANY people understand facts and learn so much about the planets. The adds don’t pop up as much as my other apps do, + they will still play the music while the add pops up so you won’t have to listen to loud, I mean LOUD music/voices from your device. Overall, I would suggest this app for people that are interested/learning about space in school it will really help with their education 😁.

Loving the app. I am so obsessed with space and this game is so amazing just to look at all the planets. I don’t own a telescope and this was amazing. I just get to look at the galaxy which I study on. This app is 5 billion stars! You guys are so amazing I can look at that app all day! Keep up all your good work! You make the App Store 100% better than it already is! Maybe even 500% better! I go on that app everyday! Well keep up the good work!

Great App To View The Solar System and Planets. I wish there was a way to fix the view as a “top down” view to see the planets orbit the sun without having the view plane being “tilted”.

Its worth it. U don’t need to go to the space to know abt the solar system, BE APPRECIATED that this app gave u for FREE, people need to go out to the space so you could download this app like this, feel thankful for this.

Wow. I wish I would’ve had some like this as a child mad don’t get me wrong. I’m learning a lot now, but if I would’ve had this tablet as a child with all these apps, oh my God where would I be now?

Live it but change one thing. I love this game but I want to enjoy this game on my computer so can you make it so that you can get this game on pc to

This app has so much education!!. Definitely get this app! It’s great for people who have an interest in space! There’s no doubt that you won’t regret getting this app! Totally cool dude!!

I have recently decided that this is not the best app.. I have decided to delete this app since I have had a bad experience. I have to admit that I will never again use this app since I am absolutely disappointed with the ads every single time I have done a few things. Please understand that I am absolutely disappointed with the way this app has been treating me whenever I use it. I just get started, do a few little things and...poof! There’s an ad! And that is why I have deleted this app since I have been disappointed with it recently! I WILL NOT SPEND MONEY ON THE PAID VERSIONS OF THESE APPS! I have better things to spend my money on.

This game is greatly designed. This game has good graphics and very cool I have one suggestion that you can try and make more galaxies and if you fail you can give up and try other suggestions from other people or you can try and try because I have high hopes that you can do it. And I seriously like this game

the best. i’ve had many star tracker and s t a r g a z e or programs. This one however has all the features you really want and none of the ones you don’t want. Could not be happier

Black Holes. If you could add Sagittarius A black hole to the center of the Milky Way I would like the game more but it’s fine already, if it’s already at the center just named something else then maybe change the name

Best solar walk app you can get!. Ok So I got this game about 3 years ago and I thought it was good and it was. I think you should add more languages like Korean. And please add like 2 - 4 more galaxies and probably the universe BTW I LOVE YOUR APP BYE (please respond and please add the things I asked for)

Fascinating Review of the Solar System. An excellent app with a variety of features -- gorgeous 3D plus basic info at your fingertips And a link to Wikipedia for additional info on each planet. Highly recommended.

I like it but I have some suggestions. Can you add Pluto’s other moons? (Only Nix and Hydra) Add the Oort Cloud (it’s beyond the Kuiper belt and shaped like a ball Add ORCUS and quaoar Add JAMES WEB TELESCOPE! It’s a new telescope Make the sun a little whiter because it’s very light yellow/white And there are some bugs you need to fix: I can see asteroids right through the planets when I view the asteroids from the back of the planet I can also sometimes see the sun through some of the planets so make sure you fix that. I know this is too much but please put this in your ideas of updates.

Cool app but two problems. It’s a cool app in all. I like how you can see the planets and the sun in super detail. but I wish you didn’t have to buy some moons and all spacecraft. And I wish the app would help you tell if the core of a planet was solid or molten.

A review. This app is used by many for educational and entertainment purposes, and to help with this I would like to point out something. Ganymede is smaller then Io. (lo?) I feel like the 3D planets and moons should be as accurate as possible. This is something you creators should fix. Also on a aside note the stuff scares me? Idk why it just does.

Make ads less generalized. I get what you're saying and what the others are saying, I know the paid version is recommended but I'm just saying make the ads focused on browsing history and likes and dislikes, get less fussing!

Wow. This app is beautiful. I love science and studying astronomy, this app has it all. The planets and stars look amazing, and I love the fact that you can view the planets structure. We need more apps like this to educate people. Thank you

You’re passing the test on this one Alvin. This rendition of the solar system visual representation gives me hope of seeing the future unfold just as it should and was spoken of newly discovered objects that will eventually appear.

Oh my. Just when you open the app and the frame zooms into the solar system and focuses on earth... Wow. Really puts into perspective how far apart the objects in our “neck of the woods” are. You can instantly focus on the sun from the earth when the suns light takes eight minutes to reach us! Mind blowing

Annoying adds. Of course when youre fully immersed in the science of the cosmos and have your entire focus on the app itself, a stupid annoying ad pops up and completely removes the enjoyment i was just in. There should be a rule that states all educational apps should not have any ads. Just a thought

Really like this app.. Really enjoy the graphics, turning the planets or moons around, flying thus space. Good, interesting info, easy navigation, nicely put together. Nice interactive intro into the heavenly bodies!

Cool app but theirs something wrong with it.... Thank you for making this app! But when you fast forward the time nothing actually happens. I want to see what happens to the solar system in the future also when I reverse the time to bc theirs still light on the city’s please make this more realistic

Cool but now boring. It’s a little boring now, but I’ve got to tell you, before it was very educational and fun, but all you can do now is just go to the planets and go backwards in time so that’s why I gave you a 4 star rating instead of a 5 star rating

Super awesome🤩. This game is awesome and I’ve only been using it a few hours. I thought it would be like the other games but this is actually the real thing! I love this game and I’m never deleting this game. Take my suggestion and DOWNLOAD NOW!!!!!!😎😎😎

Love it. This game is so cool I can see what’s on top of me it’s fascinating best game ever played all my life I love this face game it’s so cool I wanna play it every single day it’s so fascinating it’s so cool I love it cool fascinating great amazing awesome game🪐☄️💫🌕☄️🌕🪐💫🌞

Heaven and more. This is so great! I was learning so much about this app!!🤩but you need to add one more thing explodes planet going in a planet Heaven but keep up the good work this knows everything!🤩🤩and like learning to🧐🧐great app!😃😃😀😁😁

It was good but you missed somethings. Can you please add MakeMake's moon mk2 and add dactyl to the astroid Ida? That would make my space 🚀 studies much easier and it would make me happy 😊 and can you please add orcus and quaoar and 2014uz224 and can you please fix io's size cuz it looks bigger than Ganymede! Oh and please make Sedna pink not orange other wise I love the app! 😎🤗😍😅😂🤣😀😃😄😁😆😛😝😜😋😏😼😺😸😹👍🏽👍🏽👍🏽👍🏽✌🏿

Great app!. So I’m really into astronomy so I searched “space games” in the app store and when I downloaded this app I was amazed at how detailed the planets were and I was a little annoyed by the ads but other then that it was a very fun app

How solar walk life works. Well if you tap on a planet and you hit the j button there will be all kinds of little tabs were you can click on and there is a tab that shows a little star frame and you click on it it will show you pics that were taken on that planet there is a tab above the the little star picture frame if you click on it it will show you the endercore of whatever planet you choose to click solar walk life is awesome you have to get the app man or women you have to get it!!!!!!!

A different view. This app is awesome, if you want to see a different side of the galaxy we live in from the other apps this is for you, I have always wanted to be able to see the location of certain asteroids and all the different satellites that orbit the earth and with this app I like to track when something will next pass the earth and I could see it! Love the app! 5/5

I’m satisfied!. If you’re curious, or if you’re just bored, this app is a lot of fun to just explore our solar system. It’s crazy how many moons Saturn has!

Best app EVER!!!!!. I know theres not much to do in this app but I’m reaaaaally into science and even forgot how much i love this app if i could give as many stars as i want i would give it an infinity stars

I LOVE THIS APP ❤️. I LOVE THIS APP SO MUCH!!!! It gives you a accurate model of the complete solar system. I am a FAN of astronomy, and wanted a app that shows me a model of the solar system. I found this app and instantly fell in love with it! 100% recommend!!

Spectacular. It shows in real-time almost everything.

Good for teaching basics 🙂. My uncle got ipad when they first came out, and this is one of the apps he installed. Still love it! Although not as awestruck myself, looks great for teaching young kids about which planets are where. I like the option of having planets closer together or at realistic distance. PTL for this app!

love it. I really like the app but i have an idea: it would be nice if you can explore exoplanets because whenever i go to another sun it doesn’t show exoplanets so it would be really nice if you add exoplanets

Did you know that you can earn 25 USD from our site just by registering? Get $25 for free by joining Payoneer!

It’s cool. Three words I love it Wait is I a word?

Fun Game🌕🌖🌗🌘🌑🌒🌓🌔🌕. I love it and so cool 😃

BEST APP EVER. OH MY GOD this app is the best the 3D mode is so cool thank u for making this 🤣🤣🤣🤣🤣🤣🤣🤣🤣

Eiddon. Excellent I really enjoy it Thanks

Almost stunning. This app is wonderful! I would give it 5 stars if only it was not interrupted by annoying and inappropriate advertisements. I guess that is the price to pay for a free app. Maybe you should consider charging a modest purchase fee for this app and remove the ads. I would pay for it. Cheers. Hazing

Good work. Can you make more games like that this

Good, but needs more. Hello! This is a really cool app! It is also very fun to use, and it is easy to use too! I was wondering if you, the creators, could add a bit more. Like maybe the galactic centre, but or beyond the milky way galaxy. I already know many things about our solar system and beyond, but still you should add stuff past the Milky Way. No pressure! Thank you and good job on the great app!

Moon. The moon does not rotate.

299792.458km/s. This is awesome, I love it. Well done to the creators of this app👍👍👍

It’s amazing how you can see everything including space ships and stations and rovers very epic. E

Great. I I’m so interested in space and this game is awesome I love how u made it and it has so much information I’d love if could zoom out even more so u can see all galaxies and clusters also if u could add black holes that would be a dream thanks for making it I hope u read and reply

I totally like this. This is absolutely amazing this is 10/10 I’m so amazed and impressed I am impressed about the sun like how did someone know inside of the sun this is absolutely scientific keep up the good work

I love it but... I love this game but I don’t have this game but I still love this game

Absolutely gorgeous. Amazing app. Thank you.

Fantastic!. I like the planets but I don’t like the adds as much. I love the art and the satellites because they usually are in-app purchases and upgrades as well. I recommend this for stargazing lovers!

Solar walk. Great app. Informative

AWESOME. This game is awesome if the owner of the game is reading this please put in maybe like black holes or something :)

So good!. This app is really helping me in school, also this app is cool. This really helps me because right now we’re learning about space

Nothing wrong. Everything goes great and if that’s not enough it tells you when exiting things are happing

Solar Walk Lite. Go get this app and visit titan And the rest of the planets Truly brilliantly awesome thank you so much

Poo. It is poo

⭐️⭐️⭐️. Amazing app for free! Thank you Developers! Awesome work! My son is 3 and he’s in love with the Solar System. He Loves this app.

🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏🌏. This app is my 5th best app, which is not bad, also, it has no bugs! It is so awesome! I can’t wait to play it again! to: 🌏solar WALK lite🌏

School kids love it!. I use this with my Yr 5 students.It’s free, yet provides relevant, interesting info. Wishlist: It would be able to mirror/project on screen more clearly.

In my opinion. Every thing about solar walk is amazing I am pretty sure there is nothing bad about the facts are really informative it helps me with my science 🧬 at school we are learning about solar walk it has been the best experience and I just downloaded it yesterday

Good, but could be improved. I started thinking it was awesome and it was, but then it started to get boring. It could add universe’s beyond the Milky Way and could add deep space nebula’s. So that is why I rated this a 1 star.

Interest. Something coming up with Rock might hit to earth some day. See new Plant more coming and one day close to earth to see many plants make earth feel scare to close and see lot plant around!

Your app. Just a thought to orbital lines being a little more prominent would be beneficial apart from that it is amazing!

Dfghvc. Fdgvfhjvftvdgb vjc v. gffhhgfhbcbvgggggghytggfhgbgghjjhhhmkgfhfdyhfrgfdfgfthgryvvnkkkgvdnvghchnbv

Awesome 🤩. I think it is totally awesome 👏

Planet view. It would de really cool if you could see from earth while skipping time because the stars will be going around and around and around and around until it stops

Solar lite is awesome!. In this app I have learned lot’s of cool stuff about our universe, keep up the good work Solar lite creators!!!!!!

Omg 😮 amazing 😉. I have been looking for a good solar system app|game to use and I finally have found it this game is amazing keep up the amazing app One small suggestion : When you click on a planet it gives you facts at the bottom of the screen and I have been finding out a lot of things about the planets but could you please put them in order cause I am reading the same things all over again Thanks for your time hopefully you will listen 👂 to my suggestion thanks 🙏🙂👍👍

Wow. Helps me so much at school thank you

Imagine you at your best. All the time. Picture yourself at your sharpest and most productive. Your most alert and focused. Your most lucid, creative and confident. At work. At play. In every area of your life. Add Mind Lab Pro® v4.0 to your daily routine and uncap your true potential. Buy Now!

Awesome. It's so cool nothing to fix

Bug... The app won't start. The app starts, but I only see the Solar Walks and the music in the background and it stays there... Please fix

Very good. Very very good

Bravo. Bravo votre application explique toute la galaxie et mal aidée à m’endormir pour la première fois et il m’a suffi de regarder les étoiles merci

A diaphanous app that elegantly displays 3D illustrations of the universe around us. A diaphanous app that elegantly displays 3D illustrations of the universe around us This is one of the few times I’ve been forced to write an app review for an application that is so well-developed. I truly believe that by understanding the concept of space and time, humanity can be freed from its myopic vision. During my lectures, I’ve tried for years to explain astronomy of the world around us in 2D diagrams wishing there was an interactive 3D model I could use. This app is exactly what I was looking for and will be a great aid in my teaching. To the developer: can you please create a version that explores the observable universe as we know it? I, as I’m sure with others, will gladly pay for that app. Thank you for considering.

Espace. C’est très cool! Merci de l’application ☺️

Amazing 👍🏻👍🏻👍🏻. This app brings back the memories of when I was very interested in sky science and solar system! It’s so educational! The song is relaxing! I would 100% recommend it! Wish I could give 6 stars! Well done, keep up the great work!

Super app. If I had that app when I was a kid I'm certain that I would have been an astronaut (stupid me went in to network management). Great app and the three dimensional view is spectacular. The viewer gets a sense of the magical mystery of the gravitational danse of planets and the moons they entertain.

Brilliant app. Love this app. Good write ups and fun interesting graphics👍🏼

So much fun. This is so much fun I am learning so much

Average. The game is all about the solar system,the drawf planets and the space telescopes but it’s not all of the universe and galaxy

By Chris. Finally i downloaded this game — Haha, that review was made by my younger brother. He’s learning so much from your wonderful app. Keep up the great work! :)

G00D GAME 🤣🤣🤣🤣🤣. I love this game it’s so cool and it’s so fun and I like planets all of it it’s just the best😄😁🥰😍😘😋😛😇🙃🙃🤣😅😇😘😉 I love this game

Mauvais fonctionnement.... Impossible d’ouvrir l’application! Elle reste sur le titre et la musique. Que faire? Louise Rivard

best app. You are the best!

…. i love it but WAYYY too many ads.

Good game. It’s good but too many ads and doesn’t cover most of the stuff I want to see

Great 👍. I am happy I’m learning the solarSystem

Magnifique. Très intéressant, belles photos et les informations sont complètes.

Great but needs more. This game is really fun except the controls are really hard, you should add free movement so yo don’t have to rotate around something all the time, there should also be more stars like the centauri or some famous star clusters and nebulae, If you want to add more depth to the game you could also add ai generated planets and stars, other systems that again can just be ai generated, and in the future you could even add other galaxies, thank you for taking the time to read this, I would love this I really appreciate it, and it would be better if you would add some of my suggestions in to the game, cheers -Mathis

I like this game. I’m really interested in this game. I wonder if i could bring it to school tomorrow to show the kids to see the universe.

Good app. Space

Planet X. solar system 😦 what 2019

Ok. Nice graphics but kinda boring. Few seconds later an app comes out

Well done!. I thought this would give my 4 year old son a good view of the scope of our system and not much else. I couldn’t be more wrong, this app showed him that and so much more. I have to pry it from his hands just so i can try to keep up with him. He loves it so much he asked if he could bring it to his school and show everyone the planets. Well done, we have already spent hours going from planet to comet to satellite and back again. Keep up the good work!

Please get right nooooowwww. I love how you update so fast unlike the other apps

Space. The final frontier

Nice.🙂. Solar walk is a bit like 100000 stars, it’s a really good app. But I expected better graphics though...mainly when zooming on to astronomical objects, and the comet tail animation effect.

Incomplete. Even if you don’t have data, the updated actual bodies should be displayed. The only moon shown with Pluto is Charon.

I Love The App. This Is One Of The Best Apps Ever. Will There Be Any New Features?

Pretty cool!!!. Love it!

Love it !. It’s really cool to see all the planets of our solar system p.s very good graphics!🤗

moon two earth 2017. moon two earth 2017

Improvements. "pan" and directional control while in planet selection could use some help. A little more educational and dynamics info in the highlights could be nice

Best Game ever!. Thanks a lot for making this, im 10 years old and love space/solar system and astronauts. This keeps me very entertained. But also could you had the black holes? If not it’s totally fine! Great game 10/10

I love it it teaches me about the solar system, which I really want to know about. So yeah, I love it

I’m good to see how you doing this is great to hear. Hi this message was so nice

Our earth in the solar space..!. I love to find my home in 🌟God’s creation !

Good game!. I really like The game I think it’s awesome, it’s amazing how much detail you guys put in it!!! 🌏🪐✨

Adsterra is the most preferred ad network for those looking for an alternative to AdSense. Adsterra is the ideal choice for new sites with low daily traffic. In order to advertise on the site in Adsterra, like other ad networks, a certain traffic limit, domain age, etc. is required. There are no strict rules. Sign up!

I hate this game. All you can do is just look at the solar system and I can’t explore the universe. I was sad that I can’t play space engine so I was looked on the App Store and saw this game, so I thought it was gonna be some really similar but all you can do is just look at the solar system

Solar walk app. This app is the next best thing to being in space. My favorite by far of all apps!!!

Cool. This is a very great app. The only thing is that I wish we could go inside of the ISS. But marvelous app and great graphics. Love this

Review. Great app but I think we should be able to go to black holes and other galaxies and be able to go on the planets otherwise it is a good app 🌠

Not Really. Didn’t Even Have To Play. Here’s Why.. When I downloaded this game, I realized after getting in the app and waiting for a few minutes the app just stayed black so I had to delete the app for space and because it was pretty much useless. This needs to be fixed in order for me to download it again. Awaiting response.

Love this app.. ; i’ve always been a spaceman especially around seller system this app really brings the solar system much closer and I really like that

Amazing app!. it’s so cool you can zoom in and out and look anywhere in the galaxy and you can see the satellites on earth to! It’s soooooo amazing From Soren.

Ads are finally a deal breaker. It's funny that the latest version claims kid-friendly ads, because it just showed my son a naked person on an operating table. The number of ads in this app has always been ridiculous (more than one every minute) and now that they're going to be age-inappropriate, I'm done

Love for my students!!. I like to find apps that my students can download to reinforce lessons. Out of all the free ones on the SolarSystem , this is THE BEST one

This app I can see what the world look like. I like how you can do everything

Amazing learning platform. One of the best space learning platforms in the world!

Very good. This game is very realistic with planets and moons and beautiful graphics and the ability to view satellites above Earth. Highly recommend.

About in space. I love space but can u male and updated to make A lot of galaxy please

Overstanding myself.... An excellent way to understand the stars and planets made of the same stuff that we are. I’m simply star dust in my own solar system...

To many adds. I love this game but it has to many adds can u make this app without adds but over all this app is great

Events. I feel like you should put in events like the Solar Eclipse or like space travel even astroids hitting planets!

Just add some more exploring. It is a really good app, but just add like, going on planets and see images of them that’s the only thing you need to fix.

Amazing app!. Wow! I love the detail and the asteroids that you model so well! The ads are so minimal and this makes for a good app! I love the detail and the moons around Saturn! Thank you guys ( creators ) for a good app!

Uv. Great app for those who enjoy the galaxy. You can zoom in and out plus has a background music.

Heaven and more. This is so great! I was learning so much about this app!!🤩but you need to add one more thing explodes planet going in a planet Heaven but keep up the good work this knows everything!🤩🤩and like learning to🧐🧐great app!😃😃😀😁😁

Educational for kids.🤓. This could help them learn about the solar sistem. Also in school they can be smart!😁

Love it!!!. Number 2 is bad but this shows the real part of the solar system the real inside all I love this one!

Good, but some issues. When I got it on my phone, I used it already. There’s some money of it that makes It good but for others under Sixteen or Sixteen yes old, the money is bad. Thanks!

Too many ads. Every time I try to navigate back a screen, it is popping up ads. It gets to where you can't do anything without an ad showing up. Annoying. I would rather pay for something that works smoothly.

Fun app. My son loves this app and space. We found this app when he was three. He is now six and still loves it.

Awesome. This is a very detailed game with accurate settings. This app is full of wonderful features and information.

Star gazing. I love this simulation. You can see almost anything in our entire souler-system. it’s like star gazing!

Best game ever. This can help me learn about the solar system and more I didn’t know I love it already

Nice app. What a great little free app, I wish more apps would give so much enjoyment instead wanting money and giving us less fun.

Big win!. My 8 year old son has autism and he loves this app. He knows everyone by memory. He zooms in and out of the galaxy and just gets a real kick out of it. 👍🏻

Providing an honorable service. I have nothing but positive words, it is a very solid app. Consider your investment!

Good app - Constant inappropriate ads. Loved the app features. Hated that my six year old is forced to watch inappropriate ads constantly.

Not bad. But it’s not the universe at your fingertips. If it were we would be able to see more galaxies. :/

Amazing. This game has so many stuff to learn about in space I love that and also I’m a fan of space so I know that this is awesome I mean the ISS Hubble space telescope sll of thst awesome stuff just incredible!

What's with the links to some ads for games?. again what's with the ads?

So Interesting. I have long enjoyed looking at stars without a telescope and know planets don’t twinkle. 😂 Seeing colorful orbiting planets is fascinating and I’m thanking YHVH for His Creation.

The Impossible. I’ve never had more fun in my life. The planets are so beautiful.I’ve always dreamed of being in space.

The graphics are too great. The graphics are SUPER great, keep up the good work! I like learning about the solar system so this game is a guaranteed exception

One of the best app!!. Even a expensive app, doesn’t have the way this app allow user to navigate inside it!.

From me to you.. Great to zoom in on all the planets. Be nice to have the doe so we can start landing and populating the planets 🌎galaxy and onward. Love ❤️ the app.

Amazing Game. This game is so amazing! It gives you the ability to learn and explore. Thanks to the developers for making this amazing game

Love it!!!. It has everything you could want and more in a view of the solar system. The detail of the planets are wonderful. Keep it up!!!

Best app ever!. Great job! I do not experience bugs or glitches! I love how you can interact with all the planets,moons and the stars! This is very educational! I recommend this for youngsters and people who likes science!

Draw like this. I wish I could be like GOD because seeing this makes me believe I want to be with him

Awesome. No purchases or glitches so far and fairly little ads great game I highly recommend.

Fun game. It’s a fun game and it helps you learn about space you can even look at comments I learned some things that I never knew so you should try it

Beautiful!. Since I was a bit younger I loved this game and now today well I’m reviewing it and I love you hope you love my message!🌈❤️⭐️🌟✨🍬

Great App!. I really enjoy this app! I love space and it is super cool to be able to explore it. There are many things to look at and you can even explore moons of planets. I love it!!! I recommend it 100%!!!!

Review. Honestly it’s pretty good, the only thing I don’t like is: it only is the solar system & some stars

Amazing App. Every space lover should have this app. Amazing graphics and easy to use. So glad I found it!